Recombinant Human Matrix Metalloproteinase-9, MMP-9 (C-6His)

Contact us
Catalog number: CI71
Price: 1125 €
Supplier: accurate-monoclonals
Product name: Recombinant Human Matrix Metalloproteinase-9, MMP-9 (C-6His)
Quantity: 1000ul
Other quantities: 1 mg 2486€ 50 µg 496€ 500 µg 1613€
Related search:

More details :

Reacts with: Human
Source: proteins, Recombinants or rec
Description: Recombinant Human Matrix metalloproteinase-9 is produced by our Mammalian expression system and the target gene encoding Ala19-Asp707 is expressed with a 6His tag at the C-terminus
Molecular Weight: 4 kD, 77
UniProt number: P14780
State of the product: Liquid
Shipping conditions: Dry Ice/ice packs
Formulation: 0, 150 mM sodium chloride, 2 mM CaCl2, pH 7, 05% Brij35(w/v), 2 um filtered solution of 20 mM TrisHCl, 5, Supplied as a 0
Storage recommendations: -20°, Please minimize freeze-thaw cycles, stable for 6 months after receipt, C, Store at <
Reconstitution: Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml
Purity: and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid: AAPRQRQSTLVLFPGDLRTNLTDRQLAEEYLYRYGYTRVAEMRGESKSLGPALLLLQKQLSLPETGELDSATLKAMRTPRCGVPDLGRFQTFEGDLKWHHHNITYWIQNYSEDLPRAVIDDAFARAFALWSAVTPLTFTRVYSRDADIVIQFGVAEHGDGYPFDGKDGLLAHAFPPGPGIQGDAHFDDDELWSLGKGVVVPTRFGNADGAACHFPFIFEGRSYSACTTDGRSDGLPWCSTTANYDTDDRFGFCPSERLYTRDGNADGKPCQFPFIFQGQSYSACTTDGRSDGYRWCATTANYDRDKLFGFCPTRADSTVMGGNSAGELCVFPFTFLGKEYSTCTSEGRGDGRLWCATTSNFDSDKKWGFCPDQGYSLFLVAAHEFGHALGLDHSSVPEALMYPMYRFTEGPPLHKDDVNGIRHLYGPRPEPEPRPPTTTTPQPTAPPTVCPTGPPTVHPSERPTAGPTGPPSAGPTGPPTAGPSTATTVPLSPVDDACNVNIFDAIAEIGNQLYLFKDGKYWRFSEGRGSRPQGPFLIADKWPALPRKLDSVFEEPLSKKLFFFSGRQVWVYTGASVLGPRRLDKLGLGADVAQVTGALRSGRGKMLLFSGRRLWRFDVKAQMVDPRSASEVDRMFPGVPLDTHDVFQYREKAYFCQDRFYWRVSSRSELNQVDQVGYVTYDILQCPEDVDHHHHHH
Levels of endotoxin: 11 IEU/ug, LAL test shows less than than 0
Properties: Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp
Group: recombinants
Gene target: MMP-9 (C-6His), Matrix Metalloproteinase-9
Short name: MMP-9 (C-6His), Recombinant Matrix Metalloproteinase-9
Technique: E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Species: Humans, Human
Alternative name: MMP-9 (C-6His), sapiens Matrix Metalloproteinase-9, recombinant H
Alternative technique: rec

Related Products :

MBS623391 MMP15, NT (Matrix Metalloproteinase-15, MMP-15, Membrane-type Matrix Metalloproteinase 2, MT-MMP 2, MTMMP2, Membrane-type-2 Matrix Metalloproteinase, MT2-MMP, MT2MMP, SMCP-2) Antibody 200ul 603 € MBS Polyclonals_1 human
MBS624252 MMP24, ID (Matrix Metalloproteinase-24, MMP-24, Membrane-type Matrix Metalloproteinase 5, MT-MMP 5, MTMMP5, Membrane-type-5 Matrix Metalloproteinase, MT5-MMP, MT5MMP, MT5MMP) Antibody 200ul 603 € MBS Polyclonals_1 human
MBS621864 Matrix Metalloproteinase 15, Prodomain (Matrix Metallopeptidase 15 (Membrane-inserted), MMP-15, MMP15, Membrane-type Matrix Metalloproteinase 2, MT-MMP 2, MTMMP2, Membrane-type-2 Matrix Metalloproteinase, MT2-MMP, MT2MMP, SMCP-2) Antibody 100ug 641 € MBS Polyclonals_1 human
MBS618062 Matrix Metalloproteinase 16, Hinge Region (MT3-MMP, MMP-16, Membrane-type Matrix Metalloproteinase-3) Antibody 100ug 774 € MBS Polyclonals_1 human
MBS623255 MMP-2, hinge region (matrix metallopeptidase 2, 72kD Gelatinase, 72kD Type IV Collagenase, CLG4, CLG4A, Gelatinase A, Matrix Metalloproteinase-2, MMP-II, MONA, TBE-1) Antibody 100ug 674 € MBS Polyclonals_1 human
MBS616724 Matrilysin (MMP7, matrix metalloproteinase 7 (matrilysin, uterine), HGNC:7174, MMP-7, MPSL1, PUMP-1, matrin, matrix metalloproteinase 7, uterine matrilysin) Antibody 100ug 591 € MBS Polyclonals_1 human
MBS621381 Matrix Metalloproteinase 16, Prodomain (Matrix Metallopeptidase 16 (Membrane-inserted), MMP-16, MMP16, C8orf57, DKFZp761D112, Membrane-type Matrix Metalloproteinase 3, MT-MMP 3, MTMMP3, Membrane-type-3 Matrix Metalloproteinase, MT3-MMP, MT3MMP, MMP-X2, MM Antibody 100ug 641 € MBS Polyclonals_1 human
C374 Recombinant Human Matrix Metalloproteinase-1, MMP-1 (C-6His) 500 µg 1613 € novo human
C377 Recombinant Human Matrix Metalloproteinase-2, MMP-2 (C-6His) 500 µg 1613 € novo human
C378 Recombinant Human Matrix Metalloproteinase-3, MMP-3 (C-6His) 1 mg 2283 € novo human
CI71 Recombinant Human Matrix Metalloproteinase-9, MMP-9 (C-6His) 50 µg 496 € novo human
MBS623753 Matrix Metalloproteinase 7, ID (MMP-7, Matrilysin, Matrin, Pump1, Uterine Metalloproteinase, MPSL1) Antibody 200ul 603 € MBS Polyclonals_1 human
abx572303 Anti-Rat Matrix Metalloproteinase 11 (Matrix Metalloproteinase 11 (MMP11)) ELISA Kit inquire 50 € abbex rat
MBS621006 West Nile Virus, Matrix (West Nile Virus Matrix Protein, WNV Matrix Protein, Envelope Protein M, Matrix Protein, West Nile Virus Envelope Protein M) 100ug 658 € MBS Polyclonals_1 virus
MBS620959 West Nile Virus, Matrix (West Nile Virus Matrix Protein, WNV Matrix Protein, Envelope Protein M, Matrix Protein, West Nile Virus Envelope Protein M) Antibody 100ug 857 € MBS Polyclonals_1 virus
GWB-4E6B35 Matrix Metalloproteinase-9 ( MMP-9) recombinant 1 x 1 vial 971 € genways human
CC25 Recombinant Mouse Matrix Metalloproteinase-9, MMP-9 1 mg 2486 € novo mouse
AE33305HU-48 ELISA test for Human Matrix Metalloproteinase 12 (MMP-12) 1x plate of 48 wells 402 € abebio human
AE63045HU-48 ELISA test for Human Matrix metalloproteinase 13 (MMP-13) 1x plate of 48 wells 360 € abebio human
AE33295HU-48 ELISA test for Human Matrix Metalloproteinase 14 (MMP-14) 1x plate of 48 wells 402 € abebio human
AE33305HU Human Matrix Metalloproteinase 12 (MMP-12) ELISA Kit 48 wells plate 500 € ab-elisa elisas human
AE33305HU-96 Human Matrix Metalloproteinase 12 (MMP-12) ELISA Kit 1x plate of 96 wells 671 € abebio human
AE63045HU Human Matrix metalloproteinase 13 (MMP-13) ELISA Kit 48 wells plate 465 € ab-elisa elisas human
AE63045HU-96 Human Matrix metalloproteinase 13 (MMP-13) ELISA Kit 1x plate of 96 wells 587 € abebio human
AE33295HU Human Matrix Metalloproteinase 14 (MMP-14) ELISA Kit 48 wells plate 500 € ab-elisa elisas human
AE33295HU-96 Human Matrix Metalloproteinase 14 (MMP-14) ELISA Kit 1x plate of 96 wells 671 € abebio human
KT-1867 Human Matrix Metalloproteinase 9 (MMP-9) ELISA kit 96 well plate 505 € Kamiya human
MEDRPR011 MMP-19 (Matrix Metalloproteinase 19), Clone: 9F6, Mouse Monoclonal antibody-Human; paraffin, IHC 1000ul 1246 € accurate-monoclonals human
MEDRPR010-01 MMP-2 (Matrix Metalloproteinase 2), Clone: 17B11, Mouse Monoclonal antibody-Human; paraffin, IHC 0.1000ul 428 € accurate-monoclonals human
MEDRPR010-1 MMP-2 (Matrix Metalloproteinase 2), Clone: 17B11, Mouse Monoclonal antibody-Human; paraffin, IHC 1000ul 1125 € accurate-monoclonals human