| Reacts with: |
Human |
| Source: |
proteins, Recombinants or rec |
| Description: |
Recombinant Human HSD17B10 is produced by our Mammalian expression system and the target gene encoding Met1-Pro261 is expressed with a 6His tag at the C-terminus |
| Molecular Weight: |
28 kD |
| UniProt number: |
Q99714 |
| State of the product: |
Liquid |
| Shipping conditions: |
Dry ice/ice packs |
| Formulation: |
10% glycerol, 1 mM DTT &, 1M sodium chloride, 2 um filtered solution of 20 mM Trsi HCL pH-8, Supplied as a 0 |
| Storage recommendations: |
-20°, Please minimize freeze-thaw cycles, stable for 6 months after receipt, C, Store at < |
| Reconstitution: |
Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml |
| Purity: |
and determined by Polyacrylamide gel electrophoresis, Greater than 95% |
| Sequence of the amino acid: |
MAAACRSVKGLVAVITGGASGLGLATAERLVGQGASAVLLDLPNSGGEAQAKKLGNNCVFAPADVTSEKDVQTALALAKGKFGRVDVAVNCAGIAVASKTYNLKKGQTHTLEDFQRVLDVNLMGTFNVIRLVAGEMGQNEPDQGGQRGVIINTASVAAFEGQVGQAAYSASKGGIVGMTLPIARDLAPIGIRVMTIAPGLFGTPLLTSLPEKVCNFLASQVPFPSRLGDPAEYAHLVQAIIENPFLNGEVIRLDGAIRMQPVDHHHHHH |
| Levels of endotoxin: |
11 IEU/ug, LAL test shows less than than 0 |
| Properties: |
Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp |
| Group: |
recombinants |
| Gene target: |
HSD17B10 (C-6His), -Hydroxysteroid Dehydrogenase 10, 17&beta |
| Short name: |
HSD17B10 (C-6His), -Hydroxysteroid Dehydrogenase 10, Recombinant 17&beta |
| Technique: |
E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli |
| Species: |
Humans |
| Alternative name: |
HSD17B10 (C-6His), sapiens 17&beta, -Hydroxysteroid Dehydrogenase 10, recombinant H |
| Alternative technique: |
rec |
| Identity: |
4800 |
| Gene: |
HSD17B10 |
More about : HSD17B10 |
| Long gene name: |
hydroxysteroid 17-beta dehydrogenase 10 |
| Synonyms gene: |
HADH2 MRXS10 |
| Synonyms gene name: |
X-linked, hydroxyacyl-Coenzyme A dehydrogenase, hydroxyacyl-Coenzyme A dehydrogenase, syndromic 10 hydroxysteroid (17-beta) dehydrogenase 10 , type II, type II mental retardation |
| Synonyms: |
ERAB MHBD 17b-HSD10 ABAD SDR5C1 MRPP2 CAMR |
| Synonyms name: |
member 1 mitochondrial RNase P subunit 2 , type 10 17b-HSD type 10 17beta-hydroxysteroid dehydrogenase AB-binding alcohol dehydrogenase short chain dehydrogenase/reductase family 5C |
| Locus: |
Xp11, 22 |
| Discovery year: |
1997-04-25 |
| GenBank acession: |
U96132 |
| Entrez gene record: |
3028 |
| Pubmed identfication: |
9338779 16899120 19027726 18984158 17236142 |
| RefSeq identity: |
NM_004493 |
| Classification: |
X-linked mental retardation Short chain dehydrogenase/reductase superfamily |
| Havana BLAST/BLAT: |
OTTHUMG00000021612 |
| Locus Specific Databases: |
Mental Retardation database LRG_450 |