Recombinant Human 17β-Hydroxysteroid Dehydrogenase 10, HSD17B10 (C-6His)

Contact us
Catalog number: CI63
Price: 322 €
Supplier: ABM lentivectors
Product name: Recombinant Human 17β-Hydroxysteroid Dehydrogenase 10, HSD17B10 (C-6His)
Quantity: 1.0 µg DNA
Other quantities: 10 µg 202€ 50 µg 496€ 500 µg 1613€
Related search:

More details :

Reacts with: Human
Source: proteins, Recombinants or rec
Description: Recombinant Human HSD17B10 is produced by our Mammalian expression system and the target gene encoding Met1-Pro261 is expressed with a 6His tag at the C-terminus
Molecular Weight: 28 kD
UniProt number: Q99714
State of the product: Liquid
Shipping conditions: Dry ice/ice packs
Formulation: 10% glycerol, 1 mM DTT &, 1M sodium chloride, 2 um filtered solution of 20 mM Trsi HCL pH-8, Supplied as a 0
Storage recommendations: -20°, Please minimize freeze-thaw cycles, stable for 6 months after receipt, C, Store at <
Reconstitution: Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml
Purity: and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid: MAAACRSVKGLVAVITGGASGLGLATAERLVGQGASAVLLDLPNSGGEAQAKKLGNNCVFAPADVTSEKDVQTALALAKGKFGRVDVAVNCAGIAVASKTYNLKKGQTHTLEDFQRVLDVNLMGTFNVIRLVAGEMGQNEPDQGGQRGVIINTASVAAFEGQVGQAAYSASKGGIVGMTLPIARDLAPIGIRVMTIAPGLFGTPLLTSLPEKVCNFLASQVPFPSRLGDPAEYAHLVQAIIENPFLNGEVIRLDGAIRMQPVDHHHHHH
Levels of endotoxin: 11 IEU/ug, LAL test shows less than than 0
Properties: Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp
Group: recombinants
Gene target: HSD17B10 (C-6His), -Hydroxysteroid Dehydrogenase 10, 17&beta
Short name: HSD17B10 (C-6His), -Hydroxysteroid Dehydrogenase 10, Recombinant 17&beta
Technique: E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Species: Humans
Alternative name: HSD17B10 (C-6His), sapiens 17&beta, -Hydroxysteroid Dehydrogenase 10, recombinant H
Alternative technique: rec
Identity: 4800
Gene: HSD17B10 | More about : HSD17B10
Long gene name: hydroxysteroid 17-beta dehydrogenase 10
Synonyms gene: HADH2 MRXS10
Synonyms gene name: X-linked, hydroxyacyl-Coenzyme A dehydrogenase, hydroxyacyl-Coenzyme A dehydrogenase, syndromic 10 hydroxysteroid (17-beta) dehydrogenase 10 , type II, type II mental retardation
Synonyms: ERAB MHBD 17b-HSD10 ABAD SDR5C1 MRPP2 CAMR
Synonyms name: member 1 mitochondrial RNase P subunit 2 , type 10 17b-HSD type 10 17beta-hydroxysteroid dehydrogenase AB-binding alcohol dehydrogenase short chain dehydrogenase/reductase family 5C
Locus: Xp11, 22
Discovery year: 1997-04-25
GenBank acession: U96132
Entrez gene record: 3028
Pubmed identfication: 9338779 16899120 19027726 18984158 17236142
RefSeq identity: NM_004493
Classification: X-linked mental retardation Short chain dehydrogenase/reductase superfamily
Havana BLAST/BLAT: OTTHUMG00000021612
Locus Specific Databases: Mental Retardation database LRG_450

Related Products :

CI63 Recombinant Human 17β-Hydroxysteroid Dehydrogenase 10, HSD17B10 (C-6His) 1 mg 2486 € novo human
MBS614360 HADH2 (ABAD, ERAB, MHBD, HSD17B10, 17b-HSD10, Hydroxyacyl-Coenzyme A Dehydrogenase Type II, Type 10 17b-HSD, AB-binding Alcohol Dehydrogenase, Type 10 17beta-hydroxysteroid Dehydrogenase) Antibody 100ug 735 € MBS Polyclonals_1 human
EKU02008 17-Beta-Hydroxysteroid Dehydrogenase Type 10 (HSD17b10) ELISA kit 1 plate of 96 wells 844 € Biomatik ELISA kits human
DL-HSD17b10-Mu Mouse 17-Beta-Hydroxysteroid Dehydrogenase Type 10 HSD17b10 ELISA Kit 96T 921 € DL elisas mouse
EKD01001 5α-Androstane-3α, 17β diol Glucuronide (3α-Diol G) ELISA kit 1 plate of 96 wells 497 € Biomatik ELISA kits human
MBS624187 Testosterone, 17beta Antibody 100ul 707 € MBS Polyclonals_1 human
MBS616684 HADH2 (HADH2, ABAD, ERAB, MHBD, HSD17B10, 17b-HSD10, hydroxyacyl-Coenzyme A dehydrogenase, type II, type 10 17b-HSD, AB-binding alcohol dehydrogenase, type 10 17beta-hydroxysteroid dehydrogenase) 100ug 591 € MBS Polyclonals_1 human
GENTAUR-58bb52817416c Bovine 3-hydroxyacyl-CoA dehydrogenase type-2 (HSD17B10) 100ug 1768 € MBS Recombinant Proteins bovine
GENTAUR-58bb5281c821a Bovine 3-hydroxyacyl-CoA dehydrogenase type-2 (HSD17B10) 1000ug 1768 € MBS Recombinant Proteins bovine
GENTAUR-58bb528227b50 Bovine 3-hydroxyacyl-CoA dehydrogenase type-2 (HSD17B10) 100ug 2282 € MBS Recombinant Proteins bovine
GENTAUR-58bb5282729f7 Bovine 3-hydroxyacyl-CoA dehydrogenase type-2 (HSD17B10) 1000ug 2282 € MBS Recombinant Proteins bovine
AE39372RA-48 ELISA test for Rat 3-hydroxyacyl-CoA dehydrogenase type-2 (HSD17B10) 1x plate of 48 wells 373 € abebio rat
GENTAUR-58baaf1772cdc Mouse 3-hydroxyacyl-CoA dehydrogenase type-2 (Hsd17b10) 100ug 1768 € MBS Recombinant Proteins mouse
GENTAUR-58baaf18982fa Mouse 3-hydroxyacyl-CoA dehydrogenase type-2 (Hsd17b10) 1000ug 1768 € MBS Recombinant Proteins mouse
GENTAUR-58baaf190e242 Mouse 3-hydroxyacyl-CoA dehydrogenase type-2 (Hsd17b10) 100ug 2282 € MBS Recombinant Proteins mouse
GENTAUR-58baaf1970075 Mouse 3-hydroxyacyl-CoA dehydrogenase type-2 (Hsd17b10) 1000ug 2282 € MBS Recombinant Proteins mouse
GENTAUR-58b9c2f9d3db6 Rat 3-hydroxyacyl-CoA dehydrogenase type-2 (Hsd17b10) 100ug 1768 € MBS Recombinant Proteins rat
GENTAUR-58b9c2fa481b2 Rat 3-hydroxyacyl-CoA dehydrogenase type-2 (Hsd17b10) 1000ug 1768 € MBS Recombinant Proteins rat
GENTAUR-58b9c2fac88b6 Rat 3-hydroxyacyl-CoA dehydrogenase type-2 (Hsd17b10) 100ug 2282 € MBS Recombinant Proteins rat
GENTAUR-58b9c2fb3c05b Rat 3-hydroxyacyl-CoA dehydrogenase type-2 (Hsd17b10) 1000ug 2282 € MBS Recombinant Proteins rat
AE39372RA Rat 3-hydroxyacyl-CoA dehydrogenase type-2 (HSD17B10) ELISA Kit 48 wells plate 480 € ab-elisa elisas rat
AE39372RA-96 Rat 3-hydroxyacyl-CoA dehydrogenase type-2 (HSD17B10) ELISA Kit 1x plate of 96 wells 612 € abebio rat
GWB-P1520L HSD17B10, 12-261aa, Recombinant Protein bulk Ask price € genways bulk human
abx167700 Anti-11 beta Hydroxysteroid Dehydrogenase Type 1 Protein (Recombinant) 10 μg 412 € abbex human
abx167592 Anti-11 beta Hydroxysteroid Dehydrogenase Type 2 Protein (Recombinant) 100 μg 847 € abbex human
abx168371 Anti-17 beta Hydroxysteroid Dehydrogenase Type 10 Protein (Recombinant) 100 μg 862 € abbex human
abx166732 Anti-17 beta Hydroxysteroid Dehydrogenase Type 12 Protein (Recombinant) 50 μg 601 € abbex human
abx260594 Anti-Hydroxysteroid (17 beta) Dehydrogenase 10 Protein (Recombinant) 1 mg 2979 € abbex human
GWB-BSP508 HSD17B10 Human Protein bulk Ask price € genways bulk human
LV184582 HSD17B10 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV) 1.0 µg DNA 322 € ABM lentivectors human