| Reacts with: |
Human |
| Source: |
proteins, Recombinants or rec |
| Description: |
Recombinant Human Tumor Necrosis Factor Receptor II is produced by our Mammalian expression system and the target gene encoding Leu23-Asp257 is expressed with a 6His tag at the C-terminus |
| Molecular Weight: |
2 kD, 26 |
| UniProt number: |
P20333 |
| State of the product: |
Freeze-dried |
| Shipping conditions: |
Ambient temperature |
| Formulation: |
150 mM sodium chloride, 2 um filtered solution of 20 mM PB, 4, Lyophilized from a 0, pH7 |
| Storage recommendations: |
-20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at < |
| Reconstitution: |
Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml |
| Purity: |
and determined by Polyacrylamide gel electrophoresis, Greater than 95% |
| Sequence of the amino acid: |
LPAQVAFTPYAPEPGSTCRLREYYDQTAQMCCSKCSPGQHAKVFCTKTSDTVCDSCEDSTYTQLWNWVPECLSCGSRCSSDQVETQACTREQNRICTCRPGWYCALSKQEGCRLCAPLRKCRPGFGVARPGTETSDVVCKPCAPGTFSNTTSSTDICRPHQICNVVAIPGNASMDAVCTSTSPTRSMAPGAVHLPQPVSTRSQHTQPTPEPSTAPSTSFLLPMGPSPPAEGSTGDVDHHHHHH |
| Levels of endotoxin: |
11 IEU/ug, LAL test shows less than than 0 |
| Properties: |
Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp |
| Group: |
recombinants |
| Gene target: |
CD120b (C-6His), TNFRSF1B, Tumor Necrosis Factor Receptor II |
| Short name: |
CD120b (C-6His), TNFRSF1B, Recombinant Tumor Necrosis Factor Receptor II |
| Technique: |
E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli |
| Species: |
Humans, Human |
| Alternative name: |
CD120b (C-6His), member 1B, sapiens Tumor Necrosis Factor Receptor II, tumor necrosis factor receptor superfamily, recombinant H |
| Alternative technique: |
rec |
| Alternative to gene target: |
CD120b and p75 and p75TNFR and TBPII and TNF-R-II and TNF-R75 and TNFBR and TNFR1B and TNFR2 and TNFR80, TNFRSF1B and IDBG-632369 and ENSBTAG00000024928 and 338033, TNFRSF1B and IDBG-90091 and ENSG00000028137 and 7133, Tnfrsf1b and IDBG-203277 and ENSMUSG00000028599 and 21938, member 1B, nuclei, this GO :0005031 and tumor necrosis factor-activated receptor activity and molecular function this GO :0005515 and protein binding and molecular function this GO :0005576 and extracellular region and cellular component this GO :0005634 and nucleus and cellular component this GO :0005886 and plasma membrane and cellular component this GO :0006954 and inflammatory response and biological process this GO :0006955 and immune response and biological process this GO :0007166 and cell surface receptor signaling pathway and biological process this GO :0007568 and aging and biological process this GO :0008630 and intrinsic apoptotic signaling pathway in response to DNA damage and biological process this GO :0016020 and membrane and cellular component this GO :0016021 and integral component of membrane and cellular component this GO :0030424 and axon and cellular component this GO :0031625 and ubiquitin protein ligase binding and molecular function this GO :0032496 and response to lipopolysaccharide and biological process this GO :0043025 and neuronal cell body and cellular component this GO :0043196 and varicosity and cellular component this GO :0045087 and innate immune response and biological process this GO :0045121 and membrane raft and cellular component this GO :0048471 and perinuclear region of cytoplasm and cellular component this GO :0050728 and negative regulation of inflammatory response and biological process this GO :0050779 and RNA destabilization and biological process this GO :0051044 and positive regulation of membrane protein ectodomain proteolysis and biological process this GO :0071222 and cellular response to lipopolysaccharide and biological process this GO :0071363 and cellular response to growth factor stimulus and biological process this GO :0097191 and extrinsic apoptotic signaling pathway and biological process, this GO :0005031 : tumor necrosis factor-activated receptor activity, this GO :0005031 : tumor necrosis factor-activated receptor activity and also this GO :0005515 : protein binding and also this GO :0031625 : ubiquitin protein ligase binding, this GO :0005515 : protein binding, this GO :0031625 : ubiquitin protein ligase binding, ubiquitin protein ligase binding, tumor necrosis factor receptor superfamily |
| Identity: |
11917 |
| Gene: |
TNFRSF1B |
More about : TNFRSF1B |
| Long gene name: |
TNF receptor superfamily member 1B |
| Synonyms gene: |
TNFR2 |
| Synonyms gene name: |
member 1B , tumor necrosis factor receptor superfamily |
| Synonyms: |
TNFBR TNFR80 TNF-R75 TNF-R-II p75 CD120b |
| Locus: |
1p36, 22 |
| Discovery year: |
1991-01-15 |
| GenBank acession: |
M32315 |
| Entrez gene record: |
7133 |
| Pubmed identfication: |
2158863 8702885 |
| RefSeq identity: |
NM_001066 |
| Classification: |
CD molecules Tumor necrosis factor receptor superfamily |
| Havana BLAST/BLAT: |
OTTHUMG00000001829 |