Recombinant Human Prostate-Specific Antigen, , PSA, KLK3 (Ile25-Pro261, C-6His)

Contact us
Catalog number: CI30
Price: 769 €
Supplier: ab-elisa elisas
Product name: Recombinant Human Prostate-Specific Antigen, , PSA, KLK3 (Ile25-Pro261, C-6His)
Quantity: 96 wells plate
Other quantities: 10 µg 202€ 50 µg 496€ 500 µg 1613€
Related search:

More details :

Reacts with: Human
Source: proteins, Recombinants or rec
Description: Recombinant Human KLK3 is produced by our Mammalian expression system and the target gene encoding Ile25-Pro261 is expressed with a 6His tag at the C-terminus
Molecular Weight: 1 kD, 27
UniProt number: P07288
State of the product: Liquid
Shipping conditions: Dry Ice/ice packs
Formulation: 150 mM sodium chloride, 1 mM CaCl2, 2 um filtered solution of 20 mM TrisHcl, 5, Supplied as a 0, pH7
Storage recommendations: -20°, Please minimize freeze-thaw cycles, stable for 6 months after receipt, C, Store at <
Reconstitution: Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml
Purity: and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid: IVGGWECEKHSQPWQVLVASRGRAVCGGVLVHPQWVLTAAHCIRNKSVILLGRHSLFHPEDTGQVFQVSHSFPHPLYDMSLLKNRFLRPGDDSSHDLMLLRLSEPAELTDAVKVMDLPTQEPALGTTCYASGWGSIEPEEFLTPKKLQCVDLHVISNDVCAQVHPQKVTKFMLCAGRWTGGKSTCSGDSGGPLVCNGVLQGITSWGSEPCALPERPSLYTKVVHYRKWIKDTIVANPVDHHHHHH
Levels of endotoxin: 11 IEU/ug, LAL test shows less than than 0
Properties: Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp
Group: recombinants
Gene target: C-6His), KLK3 (Ile25-Pro261, PSA, Prostate-Specific
Short name: C-6His), KLK3 (Ile25-Pro261, PSA, Recombinant Prostate-Specific Antigen
Technique: E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Species: Humans, Human
Alternative name: , C-6His), KLK3 (Ile25-Pro261, PSA, sapiens Prostate-Specific protein, recombinant H
Alternative technique: rec
Identity: 6371
Gene: KLKB1 | More about : KLKB1
Long gene name: kallikrein B1
Synonyms gene: KLK3
Synonyms gene name: kallikrein B, plasma (Fletcher factor) 1
Synonyms name: Fletcher factor
Locus: 4q35, 2
Discovery year: 1999-04-23
GenBank acession: M13143
Entrez gene record: 3818
Pubmed identfication: 9535413 3521732
RefSeq identity: NM_000892
Classification: Kallikreins
Havana BLAST/BLAT: OTTHUMG00000150347

Related Products :

CI30 Recombinant Human Prostate-Specific Antigen, , PSA, KLK3 (Ile25-Pro261, C-6His) 500 µg 1613 € novo human
C365 Recombinant Human Prostate-Specific Antigen, , PSA, KLK3 (Ala18-Pro261, C-6His) 10 µg 202 € novo human
PSA20-R-10 Recombinant (HEK) Human Prostate Specific Antigen (PSA/KLKB1/Kallikrein-3/KLK3) protein (His-tag, >95%, low endotoxin, active) 10 μg 333 € adi human
PSA20-R-50 Recombinant (HEK) Human Prostate Specific Antigen (PSA/KLKB1/Kallikrein-3/KLK3) protein (His-tag, >95%, low endotoxin, active) 50 μg 1058 € adi human
MBS610873 Prostate Speci?c Antigen (PSA, Kallikrein-3, Kallikrein III, Seminin, Semenogelase, gamma-Seminoprotein, P-30 antigen, KLK3) 1 mililiter 470 € MBS Polyclonals_1 human
MBS612293 Prostate Speci?c Antigen (PSA, Kallikrein-3, Kallikrein III, Seminin, Semenogelase, gamma-Seminoprotein, P-30 antigen, KLK3) 1000ug 641 € MBS Polyclonals_1 human
MBS618778 Prostate Speci?c Antigen (PSA, Kallikrein-3, Kallikrein III, Seminin, Semenogelase, gamma-Seminoprotein, P-30 antigen, KLK3) Antibody 1 mililiter 470 € MBS Polyclonals_1 human
E-EL-Ch0336 Chicken PSA/KLK3 (Prostate Specific Antigen) ELISA Kit 96T 568 € elabsciences chicken
MEDCLA647 Prostate Specific Antigen (PSA), 34kD, Clone: PSA 28/A4, Mouse Monoclonal antibody-Human 7 ml 556 € accurate-monoclonals human
MEDCLA155 Prostate Specific Antigen (PSA), 34kD, Clone: PSA 28/A4, Mouse Monoclonal antibody-Human; frozen/paraffin, IH 1000ul 855 € accurate-monoclonals human
MEDCLA644 Prostate Specific Antigen (PSA), 34kD, Clone: PSA 28/A4, Mouse Monoclonal antibody-Human; frozen/paraffin, IH 7 ml Ask price € accurate-monoclonals human
MEDCLA645 Prostate Specific Antigen (PSA), 34kD, Clone: PSA 28/A4, Mouse Monoclonal antibody-Human; frozen/paraffin, IH 12 ml 374 € accurate-monoclonals human
MEDCLA739 Prostate Specific Antigen (PSA), 34kD, Clone: PSA 28/A4, Mouse Monoclonal antibody-Human; frozen/paraffin, IH/No WB 1000ul 855 € accurate-monoclonals human
GWB-8446B5 Kallikrein 3 Prostate specificity Antigen (KLK3/PSA) Mouse antibody to or anti-Human Monoclonal (ER-PR8) antibody 1 vial 602 € genways human
GWB-60CAD0 Kallikrein 3, Prostate specificity Antigen (KLK3/PSA) Rabbit antibody to or anti-Human Polyclonal antibody 1 tube 648 € genways human
BA1022 anti-Kallikrein-3 / PSA / KLK3 (PSA-ACT Complex) Antibody 50 Вµg 1471 € acr human
BM213-Z8B5 anti-Kallikrein-3 / PSA / KLK3 Free Prostate Antibody 0,1 mg 471 € acr human
BM214-D3C5 anti-Kallikrein-3 / PSA / KLK3 Total Prostate Antibody 0,1 mg 471 € acr human
BM214-G1E3 anti-Kallikrein-3 / PSA / KLK3 Total Prostate Antibody 0,1 mg 471 € acr human
BM214-G3D6 anti-Kallikrein-3 / PSA / KLK3 Total Prostate Antibody 0,1 mg 471 € acr human
Z7020091 Prostate Tumor Tissue Array - 17 cases of prostate tumors and 7 cases of normal and reactive prostate tissues. 5 slides 972 € BioChain human
GENTAUR-58be23dd0075e anti-human Prostate-Specific Antigen (PSA) monoclonal antibody 100ug 547 € MBS mono human
MBS301531 Anti-Human Prostate Specific Antigen (PSA) PAb 7 ml (RTU) 254 € MBS Polyclonals_1 human
MBS301532 Anti-Human Prostate Specific Antigen (PSA) PAb 100ul 188 € MBS Polyclonals_1 human
MBS301533 Anti-Human Prostate Specific Antigen (PSA) PAb 1 mililiter 332 € MBS Polyclonals_1 human
MBS302297 Anti-Human Prostate Specific Antigen (PSA) PAb 500ul 265 € MBS Polyclonals_1 human
AE36483HU-48 ELISA test for Human Prostate specific antigen (PSA) 1x plate of 48 wells 373 € abebio human
PSA17-A Goat Anti-human prostate specific antigen (PSA) IgG aff pure 1 mg 840 € adi human
PSA16-N-10 Human Prostate Specific Antigen (PSA)/ACT complex protein >99% pure 10 μg 1130 € adi human
AE36483HU Human Prostate specific antigen (PSA) ELISA Kit 96 wells plate 769 € ab-elisa elisas human