| Reacts with: |
Human |
| Source: |
proteins, Recombinants or rec |
| Description: |
Receptor agonists are often tested for drug development, FAS ligand and other ligands are binding to the receptor for signaling pathways for example in apoptosis or JNK signaling |
| Molecular Weight: |
43, 6 kD |
| UniProt number: |
P32970 |
| State of the product: |
Freeze-dried |
| Shipping conditions: |
Ambient temperature |
| Formulation: |
2 um filtered solution of phosphate buffered saline, 4, Lyophilized from a 0, pH 7 |
| Storage recommendations: |
-20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at < |
| Reconstitution: |
Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml |
| Purity: |
and determined by Polyacrylamide gel electrophoresis, Greater than 95% |
| Sequence of the amino acid: |
QQQLPLESLGWDVAELQLNHTGPQQDPRLYWQGGPALGRSFLHGPELDKGQLRIHRDGIYMVHIQVTLAICSSTTASRHHPTTLAVGICSPASRSISLLRLSFHQGCTIASQRLTPLARGDTLCTNLTGTLLPSRNTDETFFGVQWVRPVDDIEGRMDEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK |
| Levels of endotoxin: |
11 IEU/ug, LAL test shows less than than 0 |
| Properties: |
Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine, , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp |
| Group: |
recombinants |
| Gene target: |
CD70 (C-Fc), TNFSF7, CD27 Ligand |
| Short name: |
CD70 (C-Fc), TNFSF7, Recombinant CD27 Ligand |
| Technique: |
E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli |
| Species: |
Humans, Human |
| Alternative name: |
CD70 molecule (C-fragment c), TNFSF7, sapiens CD27 molecule Ligand, recombinant H |
| Alternative technique: |
rec |
| Alternative to gene target: |
CD27 and IDBG-14014 and ENSG00000139193 and 939, CD27 and IDBG-640494 and ENSBTAG00000014725 and 512514, CD27L and CD27LG and TNFSF7, CD70 and IDBG-21699 and ENSG00000125726 and 970, CD70 and IDBG-643945 and ENSBTAG00000009752 and 522074, CD70 molecule, Cd27 and IDBG-189750 and ENSMUSG00000030336 and 21940, Cd70 and IDBG-193725 and ENSMUSG00000019489 and 21948, Extracellular, Extracellular, LPFS2 and T14 and TNFRSF7 and Tp55, S152 and S152, cysteine-type endopeptidase inhibitor activity involved in apoptotic process, protein binding, this GO :0002020 and protease binding and molecular function this GO :0005102 and receptor binding and molecular function this GO :0005125 and cytokine activity and molecular function this GO :0005164 and tumor necrosis factor receptor binding and molecular function this GO :0005515 and protein binding and molecular function this GO :0005615 and extracellular space and cellular component this GO :0005886 and plasma membrane and cellular component this GO :0005887 and integral component of plasma membrane and cellular component this GO :0006955 and immune response and biological process this GO :0007165 and signal transduction and biological process this GO :0007267 and cell-cell signaling and biological process this GO :0008283 and cell proliferation and biological process this GO :0016020 and membrane and cellular component this GO :0070062 and extracellular vesicular exosome and cellular component this GO :0097191 and extrinsic apoptotic signaling pathway and biological process, this GO :0002020 : protease binding, this GO :0002020 : protease binding and also this GO :0005102 : receptor binding and also this GO :0005125 : cytokine activity and also this GO :0005164 : tumor necrosis factor receptor binding and also this GO :0005515 : protein binding, this GO :0004888 and transmembrane signaling receptor activity and molecular function this GO :0005515 and protein binding and molecular function this GO :0005576 and extracellular region and cellular component this GO :0005887 and integral component of plasma membrane and cellular component this GO :0007166 and cell surface receptor signaling pathway and biological process this GO :0008588 and release of cytoplasmic sequestered NF-kappaB and biological process this GO :0009897 and external side of plasma membrane and cellular component this GO :0009986 and cell surface and cellular component this GO :0016020 and membrane and cellular component this GO :0016064 and immunoglobulin mediated immune response and biological process this GO :0043027 and cysteine-type endopeptidase inhibitor activity involved in apoptotic process and molecular function this GO :0043066 and negative regulation of apoptotic process and biological process this GO :0043154 and negative regulation of cysteine-type endopeptidase activity involved in apoptotic process and biological process this GO :0045087 and innate immune response and biological process this GO :0045471 and response to ethanol and biological process this GO :0045579 and positive regulation of B cell differentiation and biological process this GO :0046330 and positive regulation of JNK cascade and biological process this GO :0070062 and extracellular vesicular exosome and cellular component this GO :0070233 and negative regulation of T cell apoptotic process and biological process this GO :0097191 and extrinsic apoptotic signaling pathway and biological process, this GO :0004888 : transmembrane signaling receptor activity, this GO :0004888 : transmembrane signaling receptor activity and also this GO :0005515 : protein binding and also this GO :0043027 : cysteine-type endopeptidase inhibitor activity involved in apoptotic process, this GO :0005102 : receptor binding, this GO :0005125 : cytokine activity, this GO :0005164 : tumor necrosis factor receptor binding, this GO :0005515 : protein binding, this GO :0005515 : protein binding, this GO :0043027 : cysteine-type endopeptidase inhibitor activity involved in apoptotic process, CD27 molecule |
| Identity: |
11937 |
| Gene: |
CD70 |
More about : CD70 |
| Long gene name: |
CD70 molecule |
| Synonyms gene: |
CD27LG TNFSF7 |
| Synonyms gene name: |
member 7 , tumor necrosis factor (ligand) superfamily |
| Synonyms: |
CD27L |
| Locus: |
19p13, 3 |
| Discovery year: |
1993-11-08 |
| GenBank acession: |
L08096 |
| Entrez gene record: |
970 |
| Pubmed identfication: |
8387892 8120384 |
| Classification: |
Tumor necrosis factor superfamily CD molecules |
| Havana BLAST/BLAT: |
OTTHUMG00000181834 |