Recombinant Human Apolipoprotein E, ApoE (C-6His)

Contact us
Catalog number: CI02
Price: 50 €
Supplier: abbex
Product name: Recombinant Human Apolipoprotein E, ApoE (C-6His)
Quantity: inquire
Other quantities: 1 mg 324€ 50 µg 90€ 500 µg 232€
Related search:

More details :

Reacts with: Human
Source: proteins, Recombinants or rec
Description: Recombinant Human Apolipoprotein E is produced by our Mammalian expression system and the target gene encoding Lys19-His317 is expressed with a 6His tag at the C-terminus
Molecular Weight: 3 kD, 35
UniProt number: P02649
State of the product: Freeze-dried
Shipping conditions: Ambient temperature
Formulation: 150 mM sodium chloride, 2 um filtered solution of 20 mM PB, 4, Lyophilized from a 0, pH7
Storage recommendations: -20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at <
Reconstitution: Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml
Purity: and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid: KVEQAVETEPEPELRQQTEWQSGQRWELALGRFWDYLRWVQTLSEQVQEELLSSQVTQELRALMDETMKELKAYKSELEEQLTPVAEETRARLSKELQAAQARLGADMEDVCGRLVQYRGEVQAMLGQSTEELRVRLASHLRKLRKRLLRDADDLQKRLAVYQAGAREGAERGLSAIRERLGPLVEQGRVRAATVGSLAGQPLQERAQAWGERLRARMEEMGSRTRDRLDEVKEQVAEVRAKLEEQAQQIRLQAEAFQARLKSWFEPLVEDMQRQWAGLVEKVQAAVGTSAAPVPSDNHVDHHHHHH
Levels of endotoxin: 11 IEU/ug, LAL test shows less than than 0
Properties: Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp
Group: recombinants
Gene target: ApoE (C-6His), Apolipoprotein E
Short name: ApoE (C-6His), Recombinant Apolipoprotein E
Technique: E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Species: Humans, Human
Alternative name: apolipoprotein E (C-6His), sapiens Apolipoprotein E, recombinant H
Alternative technique: rec

Related Products :

CI02 Recombinant Human Apolipoprotein E, ApoE (C-6His) 1 mg 324 € novo human
CJ05 Recombinant Mouse Apolipoprotein E, ApoE (C-6His) 10 µg 156 € novo mouse
abx575113 Anti-Human Apolipoprotein E (APOE) ELISA Kit 96 tests 673 € abbex human
GWB-DF3007 Apolipoprotein E (APOE) Goat antibody to or anti-Human Polyclonal antibody 1 vial 602 € genways human
GWB-957654 Apolipoprotein E (APOE) Goat antibody to or anti-Human Polyclonal (C- terminus) antibody 1 vial 602 € genways human
AE59361HU-48 ELISA test for Human Apolipoprotein E (APOE) 1x plate of 48 wells 360 € abebio human
MBS244044 Goat Polyclonal (IgG) to Human APOE / Apolipoprotein E Antibody 100ug 597 € MBS Polyclonals_1 human
MBS241999 Goat Polyclonal to Human APOE / Apolipoprotein E Antibody 50ug 597 € MBS Polyclonals_1 human
MBS242014 Goat Polyclonal to Human APOE / Apolipoprotein E Antibody 50ug 597 € MBS Polyclonals_1 human
MBS244196 Goat Polyclonal to Human APOE / Apolipoprotein E Antibody 50ug 597 € MBS Polyclonals_1 human
AP50075HU Human Apolipoprotein E (ApoE) 1mg 585 € AbELISA Rec human
AE59361HU Human Apolipoprotein E (APOE) ELISA Kit 96 wells plate 739 € ab-elisa elisas human
AE59361HU-96 Human Apolipoprotein E (APOE) ELISA Kit 1x plate of 96 wells 587 € abebio human
DL-APOE-Hu Human Apolipoprotein E APOE ELISA Kit 96T 788 € DL elisas human
KT-50120 Human Apolipoprotein E (ApoE) ELISA kit 96 well plate 1068 € Kamiya human
AP50075HU-100ug Human Apolipoprotein E (ApoE) Protein 0.1mg 184 € abebio human
AP50075HU-1mg Human Apolipoprotein E (ApoE) Protein 1mg 604 € abebio human
MBS248094 PAb (IgG) to Human APOE / Apolipoprotein E 50ug 597 € MBS Polyclonals_1 human
APOE13-A Rabbit Anti-Human Plasma Apolipoprotein E (ApoE) IgG, aff pure 100 μg 565 € adi human
GENTAUR-58bdc8d13d16c Anti- Apolipoprotein E (APOE) Antibody 50ug 370 € MBS Polyclonals human
GENTAUR-58bdc8d1a00c8 Anti- Apolipoprotein E (APOE) Antibody 100ug 481 € MBS Polyclonals human
GENTAUR-58bdcd865a27a Anti- Apolipoprotein E (APOE) Antibody 100ug 459 € MBS Polyclonals human
GENTAUR-58bdcd86c6cbf Anti- Apolipoprotein E (APOE) Antibody 50ug 359 € MBS Polyclonals human
GENTAUR-58bdcf0d63ed1 Anti- Apolipoprotein E (APOE) Antibody 100ug 498 € MBS Polyclonals human
GENTAUR-58bdd1d69dee3 Anti- Apolipoprotein E (APOE) Antibody 100ug 520 € MBS Polyclonals human
GENTAUR-58bddb646cf76 Anti- Apolipoprotein E (APOE) Antibody 100ug 553 € MBS Polyclonals human
GENTAUR-58bddc064b3fc Anti- Apolipoprotein E (APOE) Antibody 100ug 531 € MBS Polyclonals human
abx573448 Anti-Mouse Apolipoprotein E (APOE) ELISA Kit 96 tests 746 € abbex mouse
abx573733 Anti-Pig Apolipoprotein E (APOE) ELISA Kit inquire 50 € abbex pig
abx575819 Anti-Rabbit Apolipoprotein E (APOE) ELISA Kit inquire 50 € abbex human