Recombinant Human Acylphosphate Phosphohydrolase 1, ACYP1 (N-6His)

Contact us
Catalog number: CH97
Price: 2033 €
Supplier: MBS Recombinant Proteins
Product name: Recombinant Human Acylphosphate Phosphohydrolase 1, ACYP1 (N-6His)
Quantity: 100ug
Other quantities: 1 mg 1115€ 10 µg 100€ 500 µg 811€
Related search:

More details :

Reacts with: Human
Source: proteins, Recombinants or rec
Description: Recombinant Human Acylphosphate phosphohydrolase 1 is produced by our E, coli expression system and the target gene encoding Met1-Lys99 is expressed with a 6His tag at the N-terminus
Molecular Weight: 13, 42 kD
UniProt number: P07311
State of the product: Liquid
Shipping conditions: Dry ice/ice packs
Formulation: 1 mM DTT, 100 mM sodium chloride, 2 um filtered solution of 20 mM Tris, 20% Glycerol, Supplied as a 0, pH8
Storage recommendations: -20°, Please minimize freeze-thaw cycles, stable for 6 months after receipt, C, Store at <
Reconstitution: Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml
Purity: and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid: MGSSHHHHHHSSGLVPRGSHMAEGNTLISVDYEIFGKVQGVFFRKHTQAEGKKLGLVGWVQNTDRGTVQGQLQGPISKVRHMQEWLETRGSPKSHIDKANFNNEKVILKLDYSDFQIVK
Levels of endotoxin: 11 IEU/ug, LAL test shows less than than 0
Properties: Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp
Group: recombinants
Gene target: ACYP1 (N-6His), Acylphosphate Phosphohydrolase 1
Short name: ACYP1 (N-6His), Recombinant Acylphosphate Phosphohydrolase 1
Technique: E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Species: Humans, Human
Alternative name: ACYP1 (N-6His), sapiens Acylphosphate Phosphohydrolase 1, recombinant H
Alternative technique: rec
Identity: 179
Gene: ACYP1 | More about : ACYP1
Long gene name: acylphosphatase 1
Synonyms gene name: acylphosphatase 1, erythrocyte (common) type
Locus: 14q24, 3
Discovery year: 1998-04-21
GenBank acession: X84194
Entrez gene record: 97
Pubmed identfication: 7796909 9730610
Havana BLAST/BLAT: OTTHUMG00000171767

Related Products :

CH97 Recombinant Human Acylphosphate Phosphohydrolase 1, ACYP1 (N-6His) 500 µg 811 € novo human
CH96 Recombinant Human Acylphosphate Phosphohydrolase 2, ACYP2 (N-GST) 50 µg 303 € novo human
MBS623660 PPAP2C, CT (Lipid Phosphate Phosphohydrolase 2, Phosphatidic Acid Phosphatase 2c, PAP-2c, PAP2c, Phosphatidate Phosphohydrolase Type 2c, PAP2-gamma, PAP2-G, LPP2) Antibody 200ul 603 € MBS Polyclonals_1 human
RP-0020H Recombinant Human ACYP1 / Acylphosphatase-1 Protein (GST Tag) 20μg 456 € adv human
GWB-P1110E ACYP1, 1-99aa, Recombinant Protein bulk Ask price € genways bulk human
GWB-F73602 Acylphosphatase Organ-common Type Isozyme (ACYP1) Goat antibody to or anti-Human Polyclonal (Internal) antibody 1 vial 648 € genways human
GWB-BSP120 ACYP1 Human Protein bulk Ask price € genways bulk human
LV068071 ACYP1 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV) 1.0 µg DNA 322 € ABM lentivectors human
LV068072 ACYP1 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-C-term-HA) 1.0 µg DNA 322 € ABM lentivectors human
LV068073 ACYP1 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro) 1.0 µg DNA 322 € ABM lentivectors human
LV068074 ACYP1 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro) 1.0 µg DNA 322 € ABM lentivectors human
LV068076 ACYP1 Lentiviral Vector (Human) (EF1a) (pLenti-GIII-EF1a) 1.0 µg DNA 322 € ABM lentivectors human
LV068075 ACYP1 Lentiviral Vector (Human) (UbC) (pLenti-GIII-UbC) 1.0 µg DNA 322 € ABM lentivectors human
MBS242216 Goat Polyclonal to Human ACYP1 Antibody 50ug 597 € MBS Polyclonals_1 human
GWB-B344DC ACYP1 Over-expression Lysate reagent 1 vial 463 € genways human
AR09868PU-L anti-Acylphosphatase 1 / ACYP1 (1-99, His-tag) Antibody 0,5 mg 1138 € acr human
AR09868PU-N anti-Acylphosphatase 1 / ACYP1 (1-99, His-tag) Antibody 0,1 mg 485 € acr human
AP08980PU-N anti-Acylphosphatase 1 / ACYP1 (72-85) Antibody 50 Вµg 732 € acr human
GENTAUR-58bdefa3eca9c Anti- ACYP1 Antibody 0.06 ml 265 € MBS Polyclonals human
GENTAUR-58bdefa465493 Anti- ACYP1 Antibody 0.12 ml 348 € MBS Polyclonals human
GENTAUR-58bdf50ea8562 Anti- ACYP1 Antibody 0.12 ml 348 € MBS Polyclonals human
GENTAUR-58bdf50f1fdc7 Anti- ACYP1 Antibody 0.06 ml 265 € MBS Polyclonals human
GENTAUR-58be015af0270 Anti- ACYP1 Antibody 0.12 ml 348 € MBS Polyclonals human
GENTAUR-58be015b2e710 Anti- ACYP1 Antibody 0.06 ml 265 € MBS Polyclonals human
abx906689 Anti-ACYP1 siRNA inquire 50 € abbex human
abx906690 Anti-ACYP1 siRNA 30 nmol 717 € abbex human
MBS420385 Goat anti-ACYP1 (isoform a) Antibody 100ug 370 € MBS Polyclonals_1 human
GENTAUR-58bd76ff0e1a7 Human Diphosphoinositol polyphosphate phosphohydrolase 3-beta (NUDT11) 100ug 1531 € MBS Recombinant Proteins human
GENTAUR-58bd76ff48324 Human Diphosphoinositol polyphosphate phosphohydrolase 3-beta (NUDT11) 1000ug 1531 € MBS Recombinant Proteins human
GENTAUR-58bd76ff94547 Human Diphosphoinositol polyphosphate phosphohydrolase 3-beta (NUDT11) 100ug 2033 € MBS Recombinant Proteins human