Recombinant Human 2'-5'-Oligoadenylate Synthase-Like Protein, OASLOASL (C-6His)

Contact us
Catalog number: CH76
Price: 921 €
Supplier: DL elisas
Product name: Recombinant Human 2'-5'-Oligoadenylate Synthase-Like Protein, OASLOASL (C-6His)
Quantity: 96T
Other quantities: 10 µg 202€ 50 µg 496€ 500 µg 1613€
Related search:

More details :

Reacts with: Human
Source: proteins, Recombinants or rec
Description: Recombinant Human OASL is produced by our E, coli expression system and the target gene encoding Met1-His100 is expressed with a 6His tag at the C-terminus
Molecular Weight: 12, 6 kD
UniProt number: Q15646
State of the product: Liquid
Shipping conditions: Dry Ice/ice packs
Formulation: 150 mM sodium chloride, 2 um filtered solution of 20 mM PB, 4, Supplied as a 0, pH7
Storage recommendations: -20°, Please minimize freeze-thaw cycles, stable for 6 months after receipt, C, Store at <
Reconstitution: Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml
Purity: and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid: MALMQELYSTPASRLDSFVAQWLQPHREWKEEVLDAVRTVEEFLRQEHFQGKRGLDQDVRVLKVVKVGSFGNGTVLRSTREVELVAFLSCFHSFQEAAKHLEHHHHHH
Levels of endotoxin: 11 IEU/ug, LAL test shows less than than 0
Properties: Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp
Group: recombinants
Gene target: OASLOASL (C-6His), 2' 5' Oligoadenylate Synthase-Like Protein
Short name: OASLOASL (C-6His), Recombinant 2'-5'-Oligoadenylate Synthase-Like Protein
Technique: E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Species: Humans, Human
Alternative name: OASLOASL (C-6His), sapiens 2'-5'-Oligoadenylate Synthase-Like Protein, recombinant H
Alternative technique: rec

Related Products :

CH76 Recombinant Human 2'-5'-Oligoadenylate Synthase-Like Protein, OASLOASL (C-6His) 10 µg 202 € novo human
abx167965 Anti-2',5'-Oligoadenylate synthetase Like Protein (Recombinant) 100 μg 804 € abbex human
DL-OASL-Hu Human 2',5'-Oligoadenylate Synthetase Like Protein OASL ELISA Kit 96T 904 € DL elisas human
GWB-2AF068 Recombinant Human 2\&#039;-5\&#039; Oligoadenylate Synthetase 1 bulk Ask price € genways bulk human
abx167604 Anti-2',5'-Oligoadenylate synthetase 1 Protein (Recombinant) 50 μg 615 € abbex human
abx166587 Anti-2',5'-Oligoadenylate synthetase 2 Protein (Recombinant) 10 μg 398 € abbex human
EKU02018 2',5'-Oligoadenylate Synthetase Like Protein (OASL) ELISA kit 1 plate of 96 wells 822 € Biomatik ELISA kits human
abx129161 Anti-2',5'-Oligoadenylate synthetase Like Protein Antibody 50 μg 412 € abbex human
abx253808 Anti-Human 2'-5'-oligoadenylate synthase 1 ELISA Kit inquire 50 € abbex human
abx250264 Anti-Human 2'-5'-oligoadenylate synthase 2 ELISA Kit inquire 50 € abbex human
abx251212 Anti-Human 2'-5'-oligoadenylate synthase 3 ELISA Kit 96 tests 659 € abbex human
GWB-CE3FF7 2\&#039;-5\&#039;-oligoadenylate Synthetase 3 100kDa (OAS3) Rabbit antibody to or anti-Human Polyclonal (aa1070-1087) antibody 1 vial 602 € genways human
GWB-1497ED 2&#039;-5&#039;-oligoadenylate Synthetase E16 (OAS1) Rabbit antibody to or anti-Human Polyclonal antibody 1 x 1 vial 602 € genways human
DL-OAS1-Hu Human 2',5'-Oligoadenylate Synthetase 1 OAS1 ELISA Kit 96T 904 € DL elisas human
DL-OAS2-Hu Human 2',5'-Oligoadenylate Synthetase 2 OAS2 ELISA Kit 96T 904 € DL elisas human
DL-OAS3-Hu Human 2',5'-Oligoadenylate Synthetase 3 OAS3 ELISA Kit 96T 904 € DL elisas human
MBS621839 TBP-like Protein (TBP Like Protein TLP, TLP, TATA Box Binding Protein-like Protein 1, TBP-like 1, TBP-like Protein 1, TBPL1, 21kDa TBP-like Protein, Second TBP of Unique DNA, STUD, TATA Box Binding Protein-related Factor 2, TBP-related Factor 2, TRF2, TLF Antibody 100ug 735 € MBS Polyclonals_1 human
EKU02013 2',5'-Oligoadenylate Synthetase 1 (OAS1) ELISA kit 1 plate of 96 wells 822 € Biomatik ELISA kits human
EKU02014 2',5'-Oligoadenylate Synthetase 1 (OAS1) ELISA kit 1 plate of 96 wells 844 € Biomatik ELISA kits human
EKU02015 2',5'-Oligoadenylate Synthetase 1 (OAS1) ELISA kit 1 plate of 96 wells 888 € Biomatik ELISA kits human
EKU02016 2',5'-Oligoadenylate Synthetase 2 (OAS2) ELISA kit 1 plate of 96 wells 822 € Biomatik ELISA kits human
EKU02017 2',5'-Oligoadenylate Synthetase 3 (OAS3) ELISA kit 1 plate of 96 wells 822 € Biomatik ELISA kits human
abx257332 Anti-2, 5-oligoadenylate synthetase ELISA Kit inquire 50 € abbex human
abx130352 Anti-2',5'-Oligoadenylate synthetase 1 Antibody 100 μg 557 € abbex human
GENTAUR-58bdc20131c1e Anti- 2',5'-Oligoadenylate Synthetase 1 (OAS1) Antibody 100ug 531 € MBS Polyclonals human
GENTAUR-58bdc88cb35a1 Anti- 2',5'-Oligoadenylate Synthetase 1 (OAS1) Antibody 100ug 492 € MBS Polyclonals human
GENTAUR-58bdc88d33c28 Anti- 2',5'-Oligoadenylate Synthetase 1 (OAS1) Antibody 50ug 376 € MBS Polyclonals human
GENTAUR-58bdd7c3c3f16 Anti- 2',5'-Oligoadenylate Synthetase 1 (OAS1) Antibody 100ug 564 € MBS Polyclonals human
abx128101 Anti-2',5'-Oligoadenylate synthetase 2 Antibody 100 μg 514 € abbex human
DL-OAS1-Mu Mouse 2',5'-Oligoadenylate Synthetase 1 OAS1 ELISA Kit 96T 921 € DL elisas mouse