Recombinant Human 5-Formyltetrahydrofolate Cyclo-Ligase, MTHFS (C-6His)

Contact us
Catalog number: CH64
Price: 521 €
Supplier: genways
Product name: Recombinant Human 5-Formyltetrahydrofolate Cyclo-Ligase, MTHFS (C-6His)
Quantity: 1 vial
Other quantities: 1 mg 2486€ 50 µg 496€ 500 µg 1613€
Related search:

More details :

Reacts with: Human
Source: proteins, Recombinants or rec
Description: Recombinant Human Methenyl-THF synthetase is produced by our E, coli expression system and the target gene encoding Met1-Ala203 is expressed with a 6His tag at the C-terminus
Molecular Weight: 24, 3 kD
UniProt number: P49914
State of the product: Liquid
Shipping conditions: Dry ice/ice packs
Formulation: 1 mM DTT, 2 um filtered solution of 20 mM Tris, 200 mM sodium chloride, 50% Glycerol, Supplied as a 0, pH 8
Storage recommendations: -20°, Please minimize freeze-thaw cycles, stable for 6 months after receipt, C, Store at <
Reconstitution: Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml
Purity: and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid: MAAAAVSSAKRSLRGELKQRLRAMSAEERLRQSRVLSQKVIAHSEYQKSKRISIFLSMQDEIETEEIIKDIFQRGKICFIPRYRFQSNHMDMVRIESPEEISLLPKTSWNIPQPGEGDVREEALSTGGLDLIFMPGLGFDKHGNRLGRGKGYYDAYLKRCLQHQEVKPYTLALAFKEQICLQVPVNENDMKVDEVLYEDSSTALEHHHHHH
Levels of endotoxin: 11 IEU/ug, LAL test shows less than than 0
Properties: Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp
Group: recombinants
Gene target: MTHFS (C-6His), 5-Formyltetrahydrofolate Cyclo-Ligase
Short name: MTHFS (C-6His), Recombinant 5-Formyltetrahydrofolate Cyclo-Ligase
Technique: E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Species: Humans, Human
Alternative name: MTHFS (C-6His), sapiens 5-Formyltetrahydrofolate Cyclo-Ligase, recombinant H
Alternative technique: rec
Identity: 7437
Gene: MTHFS | More about : MTHFS
Long gene name: methenyltetrahydrofolate synthetase
Synonyms gene name: 5, 10-methenyltetrahydrofolate synthetase (5-formyltetrahydrofolate cyclo-ligase)
Synonyms: HsT19268
Synonyms name: 5, 10-methenyltetrahydrofolate synthetase 5-formyltetrahydrofolate cyclo-ligase
Locus: 15q25, 1
Discovery year: 1999-07-09
GenBank acession: L38928
Entrez gene record: 10588
Pubmed identfication: 8522195
RefSeq identity: NM_006441
Havana BLAST/BLAT: OTTHUMG00000144174

Related Products :

CH64 Recombinant Human 5-Formyltetrahydrofolate Cyclo-Ligase, MTHFS (C-6His) 1 mg 2486 € novo human
AE32458RB-48 ELISA test for Rabbit 5-formyltetrahydrofolate cyclo-ligase (MTHFS) 1x plate of 48 wells 402 € abebio human
AE32458RB-96 Rabbit 5-formyltetrahydrofolate cyclo-ligase (MTHFS) ELISA Kit 1x plate of 96 wells 671 € abebio human
GENTAUR-58b8e422c25eb Mycoplasma genitalium Probable 5-formyltetrahydrofolate cyclo-ligase (MG245) 100ug 1536 € MBS Recombinant Proteins human
GENTAUR-58b8e42349822 Mycoplasma genitalium Probable 5-formyltetrahydrofolate cyclo-ligase (MG245) 1000ug 1536 € MBS Recombinant Proteins human
GENTAUR-58b8e423b42ea Mycoplasma genitalium Probable 5-formyltetrahydrofolate cyclo-ligase (MG245) 100ug 2039 € MBS Recombinant Proteins human
GENTAUR-58b8e4243d901 Mycoplasma genitalium Probable 5-formyltetrahydrofolate cyclo-ligase (MG245) 1000ug 2039 € MBS Recombinant Proteins human
GENTAUR-58b9e03e0fb59 Mycoplasma genitalium Probable 5-formyltetrahydrofolate cyclo-ligase (MG245) 100ug 1536 € MBS Recombinant Proteins human
GENTAUR-58b9e03e6f360 Mycoplasma genitalium Probable 5-formyltetrahydrofolate cyclo-ligase (MG245) 1000ug 1536 € MBS Recombinant Proteins human
GENTAUR-58b9e03ec7ac2 Mycoplasma genitalium Probable 5-formyltetrahydrofolate cyclo-ligase (MG245) 100ug 2039 € MBS Recombinant Proteins human
GENTAUR-58b9e03f3f0c6 Mycoplasma genitalium Probable 5-formyltetrahydrofolate cyclo-ligase (MG245) 1000ug 2039 € MBS Recombinant Proteins human
GENTAUR-58b82e4a5e8ad Mycoplasma pneumoniae Probable 5-formyltetrahydrofolate cyclo-ligase (MPN_348) 100ug 1531 € MBS Recombinant Proteins human
GENTAUR-58b82e4ab0016 Mycoplasma pneumoniae Probable 5-formyltetrahydrofolate cyclo-ligase (MPN_348) 1000ug 1531 € MBS Recombinant Proteins human
GENTAUR-58b82e4b265c6 Mycoplasma pneumoniae Probable 5-formyltetrahydrofolate cyclo-ligase (MPN_348) 100ug 2033 € MBS Recombinant Proteins human
GENTAUR-58b82e4b74329 Mycoplasma pneumoniae Probable 5-formyltetrahydrofolate cyclo-ligase (MPN_348) 1000ug 2033 € MBS Recombinant Proteins human
GENTAUR-58b8a4fec701f Saccharomyces cerevisiae 5-formyltetrahydrofolate cyclo-ligase (FAU1) 100ug 1641 € MBS Recombinant Proteins human
GENTAUR-58b8a4ff16bec Saccharomyces cerevisiae 5-formyltetrahydrofolate cyclo-ligase (FAU1) 1000ug 1641 € MBS Recombinant Proteins human
GENTAUR-58b8a4ff6921e Saccharomyces cerevisiae 5-formyltetrahydrofolate cyclo-ligase (FAU1) 100ug 2155 € MBS Recombinant Proteins human
GENTAUR-58b8a4ffd6874 Saccharomyces cerevisiae 5-formyltetrahydrofolate cyclo-ligase (FAU1) 1000ug 2155 € MBS Recombinant Proteins human
GWB-P1062I MTHFS, 1-203aa, Recombinant Protein bulk Ask price € genways bulk human
GWB-BSP250 MTHFS Human Protein bulk Ask price € genways bulk human
LV229550 MTHFS Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV) 1.0 µg DNA 322 € ABM lentivectors human
AR09916PU-L anti-MTHFS (1-203, His-tag) Antibody 0,5 mg 1138 € acr human
AR09916PU-N anti-MTHFS (1-203, His-tag) Antibody 0,1 mg 485 € acr human
GENTAUR-58be4297a271c Anti- MTHFS Antibody 100ug 393 € MBS Polyclonals human
abx924920 Anti-MTHFS siRNA inquire 50 € abbex human
abx924921 Anti-MTHFS siRNA inquire 50 € abbex human
MBS421883 Goat anti-MTHFS Antibody 100ug 370 € MBS Polyclonals_1 human
GWB-MS503H MTHFS antibody 1 vial 521 € genways human
GWB-MS504I MTHFS antibody 1 vial 521 € genways human