Recombinant Human Cytochrome b-c1 Complex Subunit 6, UQCRH (N-GST)

Contact us
Catalog number: CH62
Price: 735 €
Supplier: MBS Polyclonals_1
Product name: Recombinant Human Cytochrome b-c1 Complex Subunit 6, UQCRH (N-GST)
Quantity: 100ug
Other quantities: 1 mg 2283€ 10 µg 202€ 50 µg 496€
Related search:

More details :

Reacts with: Human
Source: proteins, Recombinants or rec
Description: Recombinant Human UQCRH is produced by our E, coli expression system and the target gene encoding Met1-Lys91 is expressed with a GST tag at the N-terminus
Molecular Weight: 37, 5 kD
UniProt number: P07919
State of the product: Freeze-dried
Shipping conditions: Ambient temperature
Formulation: pH 7, 2 um filtered solution of phosphate buffered saline, 4, Lyophilized from a 0
Storage recommendations: -20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at <
Reconstitution: Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml
Purity: and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid: MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPKSDLVPRGSPEFHMGLEDEQKMLTESGDPEEEEEEEEELVDPLTTVREQCEQLEKCVKARERLELCDERVSSRSHTEEDCTEELFDFLHARDHCVAHKLFNNLK
Levels of endotoxin: 11 IEU/ug, LAL test shows less than than 0
Properties: Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp
Group: recombinants
Gene target: UQCRH (N-GST), Cytochrome b-c1 Complex Subunit 6
Short name: UQCRH (N-GST), Recombinant Cytochrome b-c1 Complex Subunit 6
Technique: E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Species: Humans, Human
Alternative name: UQCRH (N-GST), sapiens Cytochrome b-c1 aggregate functionnal sequence 6, recombinant H
Alternative technique: rec
Identity: 12590
Gene: UQCRH | More about : UQCRH
Long gene name: ubiquinol-cytochrome c reductase hinge protein
Synonyms: QCR6 UQCR8
Synonyms name: complex III subunit VIII , ubiquinol-cytochrome c reductase
Locus: 1p33
Discovery year: 1993-07-09
GenBank acession: BC001934
Entrez gene record: 7388
Pubmed identfication: 2826252
RefSeq identity: NM_006004
Classification: Mitochondrial complex III: ubiquinol-cytochrome c reductase complex subunits
Havana BLAST/BLAT: OTTHUMG00000007813

Related Products :

CH62 Recombinant Human Cytochrome b-c1 Complex Subunit 6, UQCRH (N-GST) 1 mg 2283 € novo human
GENTAUR-58bd5b16a19c6 Rat Cytochrome b-c1 complex subunit 6, mitochondrial (Uqcrh) 100ug 1304 € MBS Recombinant Proteins rat
GENTAUR-58bd5b16e8da1 Rat Cytochrome b-c1 complex subunit 6, mitochondrial (Uqcrh) 1000ug 1304 € MBS Recombinant Proteins rat
GENTAUR-58bd5b172998d Rat Cytochrome b-c1 complex subunit 6, mitochondrial (Uqcrh) 100ug 1812 € MBS Recombinant Proteins rat
GENTAUR-58bd5b176e54c Rat Cytochrome b-c1 complex subunit 6, mitochondrial (Uqcrh) 1000ug 1812 € MBS Recombinant Proteins rat
GWB-L0F4E8 UQCRH, 14-91aa, Human, His tag, E.coli bulk Ask price € genways bulk human
AR51277PU-N anti-UQCRH (Mitochondrial hinge protein) (14-91, His-tag) Antibody 0,5 mg 1109 € acr human
AR51277PU-S anti-UQCRH (Mitochondrial hinge protein) (14-91, His-tag) Antibody 0,1 mg 485 € acr human
abx905969 Anti-UQCRH siRNA 30 nmol 717 € abbex human
abx939103 Anti-UQCRH siRNA inquire 50 € abbex human
abx939104 Anti-UQCRH siRNA 15 nmol 528 € abbex human
GWB-168998 UQCRH Over-expression Lysate reagent 1 x 1 vial 463 € genways human
GSTA35-R-100 Recombinant purified human GST-alpha 3 (GST A3-3) protein biologically active 100 μg 985 € adi human
GSTA35-R-25 Recombinant purified human GST-alpha 3 (GST A3-3) protein biologically active 25 μg 405 € adi human
GSTA15-R-100 Recombinant purified human GST-alpha (GST-A1) protein biologically active 100 μg 985 € adi human
GSTA15-R-25 Recombinant purified human GST-alpha (GST-A1) protein biologically active 25 μg 405 € adi human
GSTA12-C Recombinant purified human GST-alpha (GST-A1) protein WB +ve control 100 μL 333 € adi human
GSTM25-R-100 Recombinant purified human GST-mu (GST-M1) protein biologically active 100 μg 985 € adi human
GSTM25-R-25 Recombinant purified human GST-mu (GST-M1) protein biologically active 25 μg 405 € adi human
GSTM12-C Recombinant purified human GST-mu (GST-M1) protein WB +ve control 100 μL 333 € adi human
GSTM35-R-25 Recombinant purified human GST-mu (GST-M2) protein 25 μg 405 € adi human
GSTP35-R-100 Recombinant purified human GST-pi (GST-P1) protein biologically active 100 μg 985 € adi human
GSTP35-R-25 Recombinant purified human GST-pi (GST-P1) protein biologically active 25 μg 405 € adi human
GSTP12-C Recombinant purified human GST-pi (GST-P1) protein WB +ve control 100 μL 333 € adi human
GSTT45-R-100 Recombinant purified human GST-T1-1 (GST T1-1) protein biologically active 100 μg 985 € adi human
GSTT45-R-25 Recombinant purified human GST-T1-1 (GST T1-1) protein biologically active 25 μg 405 € adi human
PTEN15-R-10 Recombinant purified Human Phosphatase and tensin homolog (PTEN-GST) fusion Protein (full length, GST-tag) 10 μg 478 € adi human
PTEN15-R-50 Recombinant purified Human Phosphatase and tensin homolog (PTEN-GST) fusion Protein (full length, GST-tag) 50 μg 1058 € adi human
PTEN11-C Recombinant purified Human PTEN-GST fusion Protein (full length, GST-tag) control for WB 100 μL 333 € adi human
MBS617387 ORC4L (Origin Recognition Complex Protein Subunit 4-Like, Origin Recognition Complex Subunit 4-like (yeast), Origin Recognition Complex Subunit 4 (yeast Homolog)-like, ORC4L Protein, ORC4P, Origin Recognition Complex Subunit 4, ORC4) Antibody 100ug 735 € MBS Polyclonals_1 human