| Reacts with: |
Human |
| Source: |
proteins, Recombinants or rec |
| Description: |
Recombinant Human Yin and Yang 1 protein is produced by our E, coli expression system and the target gene encoding Val221-Gly321 is expressed with a 6His tag at the C-terminus |
| Molecular Weight: |
12, 6 kD |
| UniProt number: |
P25490 |
| State of the product: |
Freeze-dried |
| Shipping conditions: |
Ambient temperature |
| Formulation: |
pH 7, 2 um filtered solution of phosphate buffered saline, 4, Lyophilized from a 0 |
| Storage recommendations: |
-20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at < |
| Reconstitution: |
Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml |
| Purity: |
and determined by Polyacrylamide gel electrophoresis, Greater than 95% |
| Sequence of the amino acid: |
MVTMWSSDEKKDIDHETVVEEQIIGENSPPDYSEYMTGKKLPPGGIPGIDLSDPKQLAEFARMKPRKIKEDDAPRTIACPHKGCTKMFRDNSAMRKHLHTHGLEHHHHHH |
| Levels of endotoxin: |
11 IEU/ug, LAL test shows less than than 0 |
| Properties: |
Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine, , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp |
| Group: |
recombinants |
| Gene target: |
Transcriptional Repressor Protein YY1 (C-6His) |
| Short name: |
Recombinant Transcriptional Repressor Protein YY1 (C-6His) |
| Technique: |
E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli |
| Species: |
Humans, Human |
| Alternative name: |
sapiens Transcriptional Repressor Protein YY1 (C-6His), recombinant H |
| Alternative technique: |
rec |
| Identity: |
12856 |
| Gene: |
YY1 |
More about : YY1 |
| Long gene name: |
YY1 transcription factor |
| Synonyms: |
NF-E1 DELTA UCRBP YIN-YANG-1 INO80S |
| Synonyms name: |
INO80 complex subunit S Yin and Yang 1 protein |
| Locus: |
14q32, 2 |
| Discovery year: |
1993-09-17 |
| GenBank acession: |
BC020324 |
| Entrez gene record: |
7528 |
| Pubmed identfication: |
1655281 7912122 |
| RefSeq identity: |
NM_003403 |
| Classification: |
INO80 complex Zinc fingers C2H2-type |
| Havana BLAST/BLAT: |
OTTHUMG00000150479 |