Recombinant Human Neuritin, NRN1 (N-6His)

Contact us
Catalog number: CH42
Price: 384 €
Supplier: acr
Product name: Recombinant Human Neuritin, NRN1 (N-6His)
Quantity: 20 Вµg
Other quantities: 10 µg 146€ 50 µg 303€ 500 µg 1613€
Related search:

More details :

Reacts with: Human
Source: proteins, Recombinants or rec
Description: Recombinant Human Neuritin is produced by our E, coli expression system and the target gene encoding Ala28-Gly116 is expressed with a 6His tag at the N-terminus
Molecular Weight: 1 kD, 12
UniProt number: Q9NPD7
State of the product: Freeze-dried
Shipping conditions: Ambient temperature
Formulation: 150 mM sodium chloride, 2 um filtered solution of 20 mM Tris, Lyophilized from a 0, pH 8
Storage recommendations: -20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at <
Reconstitution: Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml
Purity: and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid: MGSSHHHHHHSSGLVPRGSHMAGKCDAVFKGFSDCLLKLGDSMANYPQGLDDKTNIKTVCTYWEDFHSCTVTALTDCQEGAKDMWDKLRKESKNLNIQGSLFELCGSGNG
Levels of endotoxin: 11 IEU/ug, LAL test shows less than than 0
Properties: Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp
Group: recombinants
Gene target: NRN1 (N-6His), Neuritin
Short name: NRN1 (N-6His), Recombinant Neuritin
Technique: E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Species: Humans, Human
Alternative name: NRN1 (N-6His), sapiens Neuritin, recombinant H
Alternative technique: rec
Identity: 17972
Gene: NRN1 | More about : NRN1
Long gene name: neuritin 1
Synonyms: NRN
Locus: 6p25, 1
Discovery year: 2002-05-29
GenBank acession: AF136631
Entrez gene record: 51299
Pubmed identfication: 9122250
Havana BLAST/BLAT: OTTHUMG00000014184

Related Products :

CH42 Recombinant Human Neuritin, NRN1 (N-6His) 10 µg 146 € novo human
RP-1138H Recombinant Human NRN1 / Neuritin 1 Protein (His Tag) 20μg 572 € adv human
MBS240389 Anti-Human NRN1 / Neuritin 50ug 597 € MBS Polyclonals_1 human
GWB-C0AA14 Neuritin (NRN1) Rabbit antibody to or anti-Human Polyclonal (Internal) antibody 1 vial 602 € genways human
abx571208 Anti-Rat Neuritin 1 (NRN1) ELISA Kit inquire 50 € abbex rat
EKU06205 Neuritin 1 (NRN1) ELISA kit 1 plate of 96 wells 888 € Biomatik ELISA kits human
DL-NRN1-Ra Rat Neuritin 1 NRN1 ELISA Kit 96T 962 € DL elisas rat
GENTAUR-58b893500b4f4 Rat Neuritin (Nrn1) 100ug 1337 € MBS Recombinant Proteins rat
GENTAUR-58b893505d96a Rat Neuritin (Nrn1) 1000ug 1337 € MBS Recombinant Proteins rat
GENTAUR-58b89350cd269 Rat Neuritin (Nrn1) 100ug 1846 € MBS Recombinant Proteins rat
GENTAUR-58b89351464a4 Rat Neuritin (Nrn1) 1000ug 1846 € MBS Recombinant Proteins rat
CI43 Recombinant Human Neuritin 1-Like Protein, NRN1L (C-6His) 50 µg 303 € novo human
GWB-BIG0E5 Recombinant Human Neuritin bulk Ask price € genways bulk human
LV243244 NRN1 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV) 1.0 µg DNA 322 € ABM lentivectors human
abx262421 Anti-Neuritin-1, His Tag Protein (Recombinant) 10 µg 340 € abbex human
abx166499 Anti-Neuritin 1 Protein (Recombinant) 100 μg 804 € abbex human
abx260764 Anti-Neuritin-1 Protein (Recombinant) 1 mg 3559 € abbex human
ZR-40-507 Neuritin Recombinant Protein 0.005 mg 256 € Zyagen human
GENTAUR-58be139d49bb2 Anti- NRN1 Antibody 0.06 ml 265 € MBS Polyclonals human
GENTAUR-58be139da3620 Anti- NRN1 Antibody 0.12 ml 348 € MBS Polyclonals human
GENTAUR-58be15ae0a1b0 Anti- NRN1 Antibody 0.06 ml 265 € MBS Polyclonals human
GENTAUR-58be15ae62167 Anti- NRN1 Antibody 0.12 ml 348 € MBS Polyclonals human
abx903660 Anti-NRN1 siRNA inquire 50 € abbex human
abx926414 Anti-NRN1 siRNA 15 nmol 30 € abbexa human
abx926415 Anti-NRN1 siRNA 15 nmol 30 € abbexa human
GWB-7A0D42 NRN1 Over-expression Lysate reagent 1 tube 463 € genways human
101-M579 Anti-Human Neuritin 100ug 336 € Reliatech antibodies human
abx253900 Anti-Human Neuritin ELISA Kit inquire 50 € abbex human
AP07717PU-N anti-Neuritin Antibody 50 Вµg 732 € acr human
AR31098PU-N anti-Neuritin Antibody 20 Вµg 384 € acr human