Recombinant Human Omentin, Intelectin-1, ITLN-1 (N-6His)

Contact us
Catalog number: CH39
Price: 481 €
Supplier: MBS Polyclonals
Product name: Recombinant Human Omentin, Intelectin-1, ITLN-1 (N-6His)
Quantity: 100ug
Other quantities: 1 mg 2283€ 50 µg 369€ 500 µg 1613€
Related search:

More details :

Reacts with: Human
Source: proteins, Recombinants or rec
Description: Recombinant Human Intelectin-1 is produced by our E, coli expression system and the target gene encoding Thr19-Ser298 is expressed with a 6His tag at the N-terminus
Molecular Weight: 32, 7 kD
UniProt number: Q8WWA0
State of the product: Freeze-dried
Shipping conditions: Ambient temperature
Formulation: 0, 5 mM GSH, 0 , 100 mMsodium chloride, 2 um filtered solution of 50 mM Tris, 5 mM GSSG, Lyophilized from a 0, pH8
Storage recommendations: -20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at <
Reconstitution: Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml
Purity: and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid: MNHKVHHHHHHMTDEANTYFKEWTCSSSPSLPRSCKEIKDECPSAFDGLYFLRTENGVIYQTFCDMTSGGGGWTLVASVHENDMRGKCTVGDRWSSQQGSKAVYPEGDGNWANYNTFGSAEAATSDDYKNPGYYDIQAKDLGIWHVPNKSPMQHWRNSSLLRYRTDTGFLQTLGHNLFGIYQKYPVKYGEGKCWTDNGPVIPVVYDFGDAQKTASYYSPYGQREFTAGFVQFRVFNNERAANALCAGMRVTGCNTEHHCIGGGGYFPEASPQQCGDFSGFDWSGYGTHVGYS
Levels of endotoxin: 11 IEU/ug, LAL test shows less than than 0
Properties: Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp
Group: recombinants
Gene target: ITLN-1 (N-6His), Intelectin-1, Omentin
Short name: ITLN-1 (N-6His), Intelectin-1, Recombinant Omentin
Technique: E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Species: Humans, Human
Alternative name: ITLN-1 (N-6His), Intelectin-1, sapiens Omentin, recombinant H
Alternative technique: rec

Related Products :

CH39 Recombinant Human Omentin, Intelectin-1, ITLN-1 (N-6His) 500 µg 1613 € novo human
KT-1052 Intelectin-1/Omentin-1 (Human) ELISA kit 96 well plate 1091 € Kamiya human
AR39065PU-L anti-Intelectin-1 / Omentin (17-313) Antibody 0,5 mg 1138 € acr human
AR39065PU-N anti-Intelectin-1 / Omentin (17-313) Antibody 0,1 mg 485 € acr human
AM50067PU-N anti-Intelectin-1 / Omentin Antibody 0,1 ml 500 € acr human
AM50067PU-S anti-Intelectin-1 / Omentin Antibody 50 Вµl 369 € acr human
GENTAUR-58be4c20a2100 ITLN-1 Antibody 100ug 442 € MBS mono human
abx260698 Anti-Omentin 298 a.a. Protein (Recombinant) 5 µg 238 € abbex human
abx263032 Anti-Omentin His Tag Protein (Recombinant) 2 µg 238 € abbex human
abx262977 Anti-Omentin Protein (Recombinant) 1 mg 6691 € abbex human
MBS248218 Anti-Human ITLN1 / Omentin Antibody 50ug 597 € MBS Polyclonals_1 human
GWB-C2E6FE Omentin Human bulk Ask price € genways bulk human
abx137227 Anti-Omentin Antibody 100 µg 731 € abbex human
abx225255 Anti-Omentin Antibody 100 μl 383 € abbex human
AK9083-0002 rHu Omentin 2ug 195 € Akro Albumins and cell culture human
AK9083-0010 rHu Omentin 10ug 410 € Akro Albumins and cell culture human
AK9083-0100 rHu Omentin 100ug 1249 € Akro Albumins and cell culture human
AK9083-1000 rHu Omentin 1mg 7196 € Akro Albumins and cell culture human
abx151997 Anti-Human Intelectin 1 ELISA Kit 96 tests 847 € abbex human
abx253532 Anti-Human Intelectin 1 ELISA Kit inquire 50 € abbex human
abx574465 Anti-Human Intelectin 1 (ITLN1) ELISA Kit inquire 50 € abbex human
abx151998 Anti-Human Intelectin 2 ELISA Kit 96 tests 934 € abbex human
abx252683 Anti-Human Intelectin 2 ELISA Kit 96 tests 557 € abbex human
abx575308 Anti-Human Intelectin 2 (ITLN2) ELISA Kit inquire 50 € abbex human
AE37609HU-48 ELISA test for Human Intelectin-1 (ITLN1) 1x plate of 48 wells 373 € abebio human
AE37609HU Human Intelectin-1 (ITLN1) ELISA Kit 48 wells plate 480 € ab-elisa elisas human
AE37609HU-96 Human Intelectin-1 (ITLN1) ELISA Kit 1x plate of 96 wells 612 € abebio human
DL-ITLN1-Hu Human Intelectin 1 ITLN1 ELISA Kit 96T 846 € DL elisas human
DL-ITLN2-Hu Human Intelectin 2 ITLN2 ELISA Kit 96T 904 € DL elisas human
GENTAUR-58bdc72e16d2d Anti- Intelectin 1 (ITLN1) Antibody 100ug 481 € MBS Polyclonals human