Recombinant Human β-Casein, CSN2, CASB (N-6His)

Contact us
Catalog number: CH35
Price: 517 €
Supplier: ABM lentivectors
Product name: Recombinant Human β-Casein, CSN2, CASB (N-6His)
Quantity: 1.0 µg DNA
Other quantities: 10 µg 202€ 50 µg 496€ 500 µg 1613€
Related search:

More details :

Reacts with: Human
Source: proteins, Recombinants or rec
Description: Recombinant Human beta-casein is produced by our E, coli expression system and the target gene encoding Glu26-Val226 is expressed with a 6His tag at the N-terminus
Molecular Weight: 24, 3 kD
UniProt number: P05814
State of the product: Freeze-dried
Shipping conditions: Ambient temperature
Formulation: 2 um filtered solution of phosphate buffered saline, 4, Lyophilized from a 0, pH 7
Storage recommendations: -20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at <
Reconstitution: Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml
Purity: and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid: MNHKVHHHHHHMEESITEYKQKVEKVKHEDQQQGEDEHQDKIYPSFQPQPLIYPFVEPIPYGFLPQNILPLAQPAVVLPVPQPEIMEVPKAKDTVYTKGRVMPVLKSPTIPFFDPQIPKLTDLENLHLPLPLLQPLMQQVPQPIPQTLALPPQPLWSVPQPKVLPIPQQVVPYPQRAVPVQALLLNQELLLNPTHQIYPVTQPLAPVHNPISV
Levels of endotoxin: 11 IEU/ug, LAL test shows less than than 0
Properties: Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp
Group: recombinants
Gene target: CASB (N-6His), CSN2, &beta, -Casein
Short name: CASB (N-6His), CSN2, -Casein, Recombinant &beta
Technique: E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Species: Humans
Alternative name: CASB (N-6His), CSN2, sapiens &beta, -Casein, recombinant H
Alternative technique: rec
Identity: 2447
Gene: CSN2 | More about : CSN2
Long gene name: casein beta
Synonyms gene: CASB
Locus: 4q13, 3
Discovery year: 1987-09-11
GenBank acession: X17070
Entrez gene record: 1447
Pubmed identfication: 1577486
Havana BLAST/BLAT: OTTHUMG00000129409

Related Products :

CH35 Recombinant Human β-Casein, CSN2, CASB (N-6His) 50 µg 496 € novo human
abx576260 Anti-Human Casein Beta (CSN2) ELISA Kit inquire 50 € abbex human
DL-CSN2-Hu Human Casein Beta CSN2 ELISA Kit 96T 904 € DL elisas human
abx576259 Anti-Cow Casein Beta (CSN2) ELISA Kit inquire 50 € abbex cow
DL-CSN2-b Bovine Casein Beta CSN2 ELISA Kit 96T 1078 € DL elisas bovine
EKU02978 Casein Beta (CSN2) ELISA kit 1 plate of 96 wells 976 € Biomatik ELISA kits human
EKU02979 Casein Beta (CSN2) ELISA kit 1 plate of 96 wells 822 € Biomatik ELISA kits human
AE48691DK Donkey Beta-casein (CSN2) ELISA Kit 48 wells plate 500 € ab-elisa elisas human
AE48691DK-96 Donkey Beta-casein (CSN2) ELISA Kit 1x plate of 96 wells 671 € abebio human
AE48691DK-48 ELISA test for Donkey Beta-casein (CSN2) 1x plate of 48 wells 402 € abebio human
AE48689GO-48 ELISA test for Goat Beta-casein (CSN2) 1x plate of 48 wells 402 € abebio human
AE48688HO-48 ELISA test for Horse Beta-casein (CSN2) 1x plate of 48 wells 402 € abebio horse
AE48684RB-48 ELISA test for Rabbit Beta-casein (CSN2) 1x plate of 48 wells 402 € abebio human
AE48689GO Goat Beta-casein (CSN2) ELISA Kit 96 wells plate 810 € ab-elisa elisas human
AE48689GO-96 Goat Beta-casein (CSN2) ELISA Kit 1x plate of 96 wells 671 € abebio human
AE48688HO-96 Horse Beta-casein (CSN2) ELISA Kit 1x plate of 96 wells 671 € abebio horse
AE48684RB Rabbit Beta-casein (CSN2) ELISA Kit 96 wells plate 810 € ab-elisa elisas human
AE48684RB-96 Rabbit Beta-casein (CSN2) ELISA Kit 1x plate of 96 wells 671 € abebio human
GENTAUR-58bd9e0d7f17f Trichosurus vulpecula Beta-casein (CSN2) 100ug 1796 € MBS Recombinant Proteins human
GENTAUR-58bd9e0e043d2 Trichosurus vulpecula Beta-casein (CSN2) 1000ug 1796 € MBS Recombinant Proteins human
GENTAUR-58bd9e0e7cad0 Trichosurus vulpecula Beta-casein (CSN2) 100ug 2310 € MBS Recombinant Proteins human
GENTAUR-58bd9e0eed7fb Trichosurus vulpecula Beta-casein (CSN2) 1000ug 2310 € MBS Recombinant Proteins human
MBS621351 Casein Kinase 1 epsilon (Casein Kinase I epsilon, Casein Kinase I Isoform epsilon, CKI epsilon, CKIe, CK1 epsilon, CSNK1E, HCKIE, KC1E, Kinase CK1 epsilon, MGC10398) Antibody 100ug 735 € MBS Polyclonals_1 human
CG70 Recombinant Human Casein kinase I γ-2, CSNK1G2 (N-6His) 10 µg 146 € novo human
MBS613688 Casein Kinase 1, delta (CSNK1D, Casein Kinase 1, delta, HGNC:2452, HCKID, CKIdelta) Antibody 100ug 735 € MBS Polyclonals_1 human
GWB-P0608J CSN2, 16-226aa , Human, His tag, E.coli bulk Ask price € genways bulk human
LV128399 CSN2 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV) 1.0 µg DNA 517 € ABM lentivectors human
LV128400 CSN2 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-C-term-HA) 1.0 µg DNA 517 € ABM lentivectors human
LV128401 CSN2 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro) 1.0 µg DNA 517 € ABM lentivectors human
LV128402 CSN2 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro) 1.0 µg DNA 517 € ABM lentivectors human