Recombinant Human GABA(A) Receptor-Associated Protein, GABARAP (N-6His, C-Fc)

Contact us
Catalog number: CH32
Price: 732 €
Supplier: acr
Product name: Recombinant Human GABA(A) Receptor-Associated Protein, GABARAP (N-6His, C-Fc)
Quantity: 50 Вµg
Other quantities: 1 mg 2283€ 500 µg 1613€
Related search:

More details :

Reacts with: Human
Source: proteins, Recombinants or rec
Description: Fc tag at the C-terminus, Recombinant Human GABARAP is produced by our E, coli expression system and the target gene encoding Met1-Gln116 is expressed with a 6His tag at the N-terminus
Molecular Weight: 2 kD, 43
UniProt number: Q6IAW1
State of the product: Liquid
Shipping conditions: Dry ice/ice packs
Formulation: 150 mM sodium chloride, 2 um filtered solution of 20 mM PB, 20% glycerol, Supplied as a 0, pH7
Storage recommendations: -20°, Please minimize freeze-thaw cycles, stable for 6 months after receipt, C, Store at <
Reconstitution: Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml
Purity: and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid: MGSSHHHHHHSSGLVPRGSHMKFVYKEEHPFEKRRSEGEKIRKKYPDRVPVIVEKAPKARIGDLDKKKYLVPSDLTVGQFYFLIRKRIHLRAEDALFFFVNNVIPPTSATMGQLYQEHHEEDFFLYIAYSDESVYGLVDDIEGRMDEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
Levels of endotoxin: 11 IEU/ug, LAL test shows less than than 0
Properties: Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp
Group: recombinants
Gene target: C-Fc), GABARAP (N-6His, GABA(A) Receptor-Associated Protein
Short name: C-Fc), GABARAP (N-6His, Recombinant GABA(A) Receptor-Associated Protein
Technique: E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Species: Humans, Human
Alternative name: C-fragment c), GABARAP (N-6His, sapiens GABA(A) Receptor-Associated Protein, recombinant H
Alternative technique: rec
Identity: 4067
Gene: GABARAP | More about : GABARAP
Long gene name: GABA type A receptor-associated protein
Synonyms gene name: GABA(A) receptor-associated protein
Synonyms: MM46 ATG8A
Locus: 17p13, 1
Discovery year: 1999-09-29
GenBank acession: AF161586
Entrez gene record: 11337
Pubmed identfication: 9892355
Classification: Autophagy related
Havana BLAST/BLAT: OTTHUMG00000102156

Related Products :

CH32 Recombinant Human GABA(A) Receptor-Associated Protein, GABARAP (N-6His, C-Fc) 1 mg 2283 € novo human
MBS611860 GABARAP L2 (Gamma-aminobutyric acid receptor-associated protein-like 2, GABA(A) receptor-associated protein-like 2, Ganglioside expression factor 2, GEF-2, General protein transport factor p16, MAP1 light chain 3-related protein, ATG8, GATE16, GABARAPL2, 50ug 884 € MBS Polyclonals_1 human
C143 Recombinant Human GABA(A) Receptor-Associated Protein, GABARAP (N-GST) 500 µg 248 € novo human
abx261893 Anti-GABA(A) Receptor-Associated Protein Like 1 Protein (Recombinant) 20 µg 340 € abbex human
abx262466 Anti-GABA(A) Receptor-Associated Protein Like 2 Protein (Recombinant) 1 mg 6662 € abbex human
abx260568 Anti-GABA(A) Receptor-Associated Protein (Recombinant) 10 µg 238 € abbex human
GENTAUR-58bd1646476e7 Human Gamma-aminobutyric acid receptor-associated protein (GABARAP) 100ug 1409 € MBS Recombinant Proteins human
GENTAUR-58bd164696ea8 Human Gamma-aminobutyric acid receptor-associated protein (GABARAP) 1000ug 1409 € MBS Recombinant Proteins human
GENTAUR-58bd1646d90bf Human Gamma-aminobutyric acid receptor-associated protein (GABARAP) 100ug 1912 € MBS Recombinant Proteins human
GENTAUR-58bd16472dd2a Human Gamma-aminobutyric acid receptor-associated protein (GABARAP) 1000ug 1912 € MBS Recombinant Proteins human
GENTAUR-58bd9035355e8 Rabbit Gamma-aminobutyric acid receptor-associated protein (GABARAP) 100ug 1409 € MBS Recombinant Proteins human
GENTAUR-58bd9035bdc45 Rabbit Gamma-aminobutyric acid receptor-associated protein (GABARAP) 1000ug 1409 € MBS Recombinant Proteins human
GENTAUR-58bd90362b215 Rabbit Gamma-aminobutyric acid receptor-associated protein (GABARAP) 100ug 1912 € MBS Recombinant Proteins human
GENTAUR-58bd903682069 Rabbit Gamma-aminobutyric acid receptor-associated protein (GABARAP) 1000ug 1912 € MBS Recombinant Proteins human
GENTAUR-58bb0d9a98bab Rat Gamma-aminobutyric acid receptor-associated protein (Gabarap) 100ug 1409 € MBS Recombinant Proteins rat
GENTAUR-58bb0d9ae70c1 Rat Gamma-aminobutyric acid receptor-associated protein (Gabarap) 1000ug 1409 € MBS Recombinant Proteins rat
GENTAUR-58bb0d9b38787 Rat Gamma-aminobutyric acid receptor-associated protein (Gabarap) 100ug 1912 € MBS Recombinant Proteins rat
GENTAUR-58bb0d9b84de9 Rat Gamma-aminobutyric acid receptor-associated protein (Gabarap) 1000ug 1912 € MBS Recombinant Proteins rat
GENTAUR-58bb3914dd920 Rat Gamma-aminobutyric acid receptor-associated protein (Gabarap) 100ug 1409 € MBS Recombinant Proteins rat
GENTAUR-58bb39153b46c Rat Gamma-aminobutyric acid receptor-associated protein (Gabarap) 1000ug 1409 € MBS Recombinant Proteins rat
GENTAUR-58bb39157b4ec Rat Gamma-aminobutyric acid receptor-associated protein (Gabarap) 100ug 1912 € MBS Recombinant Proteins rat
GENTAUR-58bb3915caeca Rat Gamma-aminobutyric acid receptor-associated protein (Gabarap) 1000ug 1912 € MBS Recombinant Proteins rat
AP05917PU-N anti-GABAA Receptor alpha 6 Antibody 0,1 ml 790 € acr human
AP21175PU-N anti-GABAA Receptor alpha 6 Antibody 0,1 mg 558 € acr human
C15852-1 anti-GABAA Receptor alpha 6 Antibody 50 Вµg 347 € acr human
C15852-2 anti-GABAA Receptor alpha 6 Antibody 0,1 mg 500 € acr human
CPA4414-100ul anti-GABAA Receptor alpha 6 Antibody 0,1 ml 442 € acr human
CPA4414-200ul anti-GABAA Receptor alpha 6 Antibody 0,2 ml 688 € acr human
CPA4414-30ul anti-GABAA Receptor alpha 6 Antibody 30 Вµl 326 € acr human
AP22584PU-N anti-GABAA Receptor alpha 6 (Internal) Antibody 50 Вµg 732 € acr human