| Reacts with: |
Human |
| Source: |
proteins, Recombinants or rec |
| Description: |
Recombinant Human Hepcidin is produced by our E, coli expression system and the target gene encoding Asp60-Thr84 is expressed with a GST tag at the N-terminus |
| Molecular Weight: |
2, 92 kD |
| UniProt number: |
P81172 |
| State of the product: |
Liquid |
| Shipping conditions: |
Dry ice/ice packs |
| Formulation: |
2 um filtered solution of phosphate buffered saline,50%glycerol,pH7, 4, Supplied as a 0 |
| Storage recommendations: |
-20°, Please minimize freeze-thaw cycles, stable for 6 months after receipt, C, Store at < |
| Reconstitution: |
Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml |
| Purity: |
and determined by Polyacrylamide gel electrophoresis, Greater than 95% |
| Sequence of the amino acid: |
MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPKSDLVPRGSENLYFQGHMDTHFPICIFCCGCCHRSKCGMCCKT |
| Levels of endotoxin: |
11 IEU/ug, LAL test shows less than than 0 |
| Properties: |
Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp |
| Group: |
recombinants |
| Gene target: |
HAMP (N-GST), Hepcidin |
| Short name: |
HAMP (N-GST), Recombinant Hepcidin |
| Technique: |
E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli |
| Species: |
Humans, Human |
| Alternative name: |
hepcidin antimicrobial peptide (N-GST), sapiens Hepcidin, recombinant H |
| Alternative technique: |
rec |
| Alternative to gene target: |
Extracellular, HAMP and IDBG-43921 and ENSG00000105697 and 57817, HAMP and IDBG-635586 and ENSBTAG00000017042 and 512301, hormone activity, this GO :0005179 and hormone activity and molecular function this GO :0005576 and extracellular region and cellular component this GO :0005737 and cytoplasm and cellular component this GO :0006879 and cellular iron ion homeostasis and biological process this GO :0006955 and immune response and biological process this GO :0031640 and killing of cells of other organism and biological process this GO :0042742 and defense response to bacterium and biological process this GO :0045087 and innate immune response and biological process this GO :0045179 and apical cortex and cellular component this GO :0050832 and defense response to fungus and biological process, this GO :0005179 : hormone activity, this GO :0005179 : hormone activity, hepcidin antimicrobial peptide |
| Identity: |
15598 |
| Gene: |
HAMP |
More about : HAMP |
| Long gene name: |
hepcidin antimicrobial peptide |
| Synonyms: |
LEAP-1 HEPC HFE2B LEAP1 |
| Locus: |
19q13, 12 |
| Discovery year: |
2001-05-29 |
| GenBank acession: |
AF309489 |
| Entrez gene record: |
57817 |
| Pubmed identfication: |
11034317 11113132 |
| RefSeq identity: |
NM_021175 |
| Havana BLAST/BLAT: |
OTTHUMG00000183295 |
| Locus Specific Databases: |
LRG_791 |