Recombinant Human Hepcidin, HAMP (N-GST)

Contact us
Catalog number: CH13
Price: 333 €
Supplier: adi
Product name: Recombinant Human Hepcidin, HAMP (N-GST)
Quantity: 100 μL
Other quantities: 1 mg 2486€ 10 µg 202€ 500 µg 1755€
Related search:

More details :

Reacts with: Human
Source: proteins, Recombinants or rec
Description: Recombinant Human Hepcidin is produced by our E, coli expression system and the target gene encoding Asp60-Thr84 is expressed with a GST tag at the N-terminus
Molecular Weight: 2, 92 kD
UniProt number: P81172
State of the product: Liquid
Shipping conditions: Dry ice/ice packs
Formulation: 2 um filtered solution of phosphate buffered saline,50%glycerol,pH7, 4, Supplied as a 0
Storage recommendations: -20°, Please minimize freeze-thaw cycles, stable for 6 months after receipt, C, Store at <
Reconstitution: Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml
Purity: and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid: MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPKSDLVPRGSENLYFQGHMDTHFPICIFCCGCCHRSKCGMCCKT
Levels of endotoxin: 11 IEU/ug, LAL test shows less than than 0
Properties: Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp
Group: recombinants
Gene target: HAMP (N-GST), Hepcidin
Short name: HAMP (N-GST), Recombinant Hepcidin
Technique: E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Species: Humans, Human
Alternative name: hepcidin antimicrobial peptide (N-GST), sapiens Hepcidin, recombinant H
Alternative technique: rec
Alternative to gene target: Extracellular, HAMP and IDBG-43921 and ENSG00000105697 and 57817, HAMP and IDBG-635586 and ENSBTAG00000017042 and 512301, hormone activity, this GO :0005179 and hormone activity and molecular function this GO :0005576 and extracellular region and cellular component this GO :0005737 and cytoplasm and cellular component this GO :0006879 and cellular iron ion homeostasis and biological process this GO :0006955 and immune response and biological process this GO :0031640 and killing of cells of other organism and biological process this GO :0042742 and defense response to bacterium and biological process this GO :0045087 and innate immune response and biological process this GO :0045179 and apical cortex and cellular component this GO :0050832 and defense response to fungus and biological process, this GO :0005179 : hormone activity, this GO :0005179 : hormone activity, hepcidin antimicrobial peptide
Identity: 15598
Gene: HAMP | More about : HAMP
Long gene name: hepcidin antimicrobial peptide
Synonyms: LEAP-1 HEPC HFE2B LEAP1
Locus: 19q13, 12
Discovery year: 2001-05-29
GenBank acession: AF309489
Entrez gene record: 57817
Pubmed identfication: 11034317 11113132
RefSeq identity: NM_021175
Havana BLAST/BLAT: OTTHUMG00000183295
Locus Specific Databases: LRG_791

Related Products :

CH13 Recombinant Human Hepcidin, HAMP (N-GST) 50 µg 496 € novo human
MBS247094 Goat Polyclonal to Human HAMP / Hepcidin Antibody 50ug 597 € MBS Polyclonals_1 human
GENTAUR-58bde7735fced Mouse Monoclonal [clone 1F9] (IgG1,k) to Human HAMP / Hepcidin Antibody 50ug 663 € MBS mono human
AM21007PU-N anti-Hepcidin / HAMP (25-85) Antibody 50 Вµg 819 € acr human
AP10446PU-N anti-Hepcidin / HAMP Antibody 0,1 mg 659 € acr human
AP10446SU-N anti-Hepcidin / HAMP Antibody 0,2 ml 630 € acr human
AP51998PU-N anti-Hepcidin / HAMP (Center) Antibody 0,4 ml 587 € acr human
AE40492PI-48 ELISA test for Pig Hepcidin (HAMP) 1x plate of 48 wells 402 € abebio pig
GENTAUR-58bd5311e7f8a Larimichthys crocea Hepcidin (hamp) 1000ug 1569 € MBS Recombinant Proteins human
GENTAUR-58bd53123a2c0 Larimichthys crocea Hepcidin (hamp) 1000ug 2078 € MBS Recombinant Proteins human
GENTAUR-58bc6c6f66d22 Morone chrysops x Morone saxatilis Hepcidin (hamp) 1000ug 1569 € MBS Recombinant Proteins human
GENTAUR-58bc6c6fe6874 Morone chrysops x Morone saxatilis Hepcidin (hamp) 1000ug 2078 € MBS Recombinant Proteins human
AE40492PI-96 Pig Hepcidin (HAMP) ELISA Kit 1x plate of 96 wells 671 € abebio pig
GSTA35-R-100 Recombinant purified human GST-alpha 3 (GST A3-3) protein biologically active 100 μg 985 € adi human
GSTA35-R-25 Recombinant purified human GST-alpha 3 (GST A3-3) protein biologically active 25 μg 405 € adi human
GSTA15-R-100 Recombinant purified human GST-alpha (GST-A1) protein biologically active 100 μg 985 € adi human
GSTA15-R-25 Recombinant purified human GST-alpha (GST-A1) protein biologically active 25 μg 405 € adi human
GSTA12-C Recombinant purified human GST-alpha (GST-A1) protein WB +ve control 100 μL 333 € adi human
GSTM25-R-100 Recombinant purified human GST-mu (GST-M1) protein biologically active 100 μg 985 € adi human
GSTM25-R-25 Recombinant purified human GST-mu (GST-M1) protein biologically active 25 μg 405 € adi human
GSTM12-C Recombinant purified human GST-mu (GST-M1) protein WB +ve control 100 μL 333 € adi human
GSTM35-R-25 Recombinant purified human GST-mu (GST-M2) protein 25 μg 405 € adi human
GSTP35-R-100 Recombinant purified human GST-pi (GST-P1) protein biologically active 100 μg 985 € adi human
GSTP35-R-25 Recombinant purified human GST-pi (GST-P1) protein biologically active 25 μg 405 € adi human
GSTP12-C Recombinant purified human GST-pi (GST-P1) protein WB +ve control 100 μL 333 € adi human
GSTT45-R-100 Recombinant purified human GST-T1-1 (GST T1-1) protein biologically active 100 μg 985 € adi human
GSTT45-R-25 Recombinant purified human GST-T1-1 (GST T1-1) protein biologically active 25 μg 405 € adi human
PTEN15-R-10 Recombinant purified Human Phosphatase and tensin homolog (PTEN-GST) fusion Protein (full length, GST-tag) 10 μg 478 € adi human
PTEN15-R-50 Recombinant purified Human Phosphatase and tensin homolog (PTEN-GST) fusion Protein (full length, GST-tag) 50 μg 1058 € adi human
PTEN11-C Recombinant purified Human PTEN-GST fusion Protein (full length, GST-tag) control for WB 100 μL 333 € adi human