Recombinant Human Interleukin-1β, IL-1β

Contact us
Catalog number: CG93
Price: 410 €
Supplier: abebio
Product name: Recombinant Human Interleukin-1β, IL-1β
Quantity: 1x plate of 96 wells
Other quantities: 1 mg 2283€ 10 µg 156€ 500 µg 1613€
Related search:

More details :

Reacts with: Human
Source: proteins, Recombinants or rec
Description: Recombinant Human Interleukin-1 beta is produced by our E, coli expression system and the target gene encoding Ala117-Ser269 is expressed
Molecular Weight: 17, 5 kD
UniProt number: P01584
State of the product: Freeze-dried
Shipping conditions: Ambient temperature
Formulation: 150 mM sodium chloride, 2 um filtered solution of 20 mM PB, 4, Lyophilized from a 0, pH7
Storage recommendations: -20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at <
Reconstitution: Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml
Purity: and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid: MAPVRSLNCTLRDSQQKSLVMSGPYELKALHLQGQDMEQQVVFSMSFVQGEESNDKIPVALGLKEKNLYLSCVLKDDKPTLQLESVDPKNYPKKKMEKRFVFNKIEINNKLEFESAQFPNWYISTSQAENMPVFLGGTKGGQDITDFTMQFVSS
Levels of endotoxin: 11 IEU/ug, LAL test shows less than than 0
Properties: Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp
Group: recombinants
Gene target: IL-1&beta, Interleukin-1&beta
Short name: IL-1&beta, Recombinant Interleukin-1&beta
Technique: E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Species: Humans
Alternative name: Interleukin-1&beta, sapiens Interleukin-1&beta, recombinant H
Alternative technique: rec

Related Products :

CG93 Recombinant Human Interleukin-1β, IL-1β 500 µg 1613 € novo human
C042 Recombinant Mouse Interleukin-1β, IL-1β 50 µg 496 € novo human
AE58504HU-48 ELISA test for Human Interleukin 1β (IL-1β) 1x plate of 48 wells 272 € abebio human
AE58504HU Human Interleukin 1β (IL-1β) ELISA Kit 48 wells plate 358 € ab-elisa elisas human
AE58504HU-96 Human Interleukin 1β (IL-1β) ELISA Kit 1x plate of 96 wells 410 € abebio human
YV0358-01 Bovine Interleukin-1β (IL-1β), Clone: IL-1 8.1, Mouse Monoclonal antibody-Bovine 0.1 mg 354 € accurate-monoclonals human
YV0358-05 Bovine Interleukin-1β (IL-1β), Clone: IL-1 8.1, Mouse Monoclonal antibody-Bovine 0.5 mg Ask price € accurate-monoclonals human
YV0359-01 Bovine Interleukin-1β (IL-1β), Clone: IL-1 9.3, Mouse Monoclonal antibody-Bovine 0.1 mg 354 € accurate-monoclonals human
YV0359-05 Bovine Interleukin-1β (IL-1β), Clone: IL-1 9.3, Mouse Monoclonal antibody-Bovine 0.5 mg Ask price € accurate-monoclonals human
AE38408BO Bovine Interleukin 1β (IL- 1β) ELISA Kit 48 wells plate 465 € ab-elisa elisas human
AE38408BO-96 Bovine Interleukin 1β (IL- 1β) ELISA Kit 1x plate of 96 wells 587 € abebio human
AE38405DO Canine Interleukin 1β (IL- 1β) ELISA Kit 48 wells plate 515 € ab-elisa elisas human
AE38405DO-96 Canine Interleukin 1β (IL- 1β) ELISA Kit 1x plate of 96 wells 671 € abebio human
AE38408BO-48 ELISA test for Bovine Interleukin 1β (IL- 1β) 1x plate of 48 wells 360 € abebio human
AE38405DO-48 ELISA test for Canine Interleukin 1β (IL- 1β) 1x plate of 48 wells 402 € abebio human
AE58501FI-48 ELISA test for Fish Interleukin 1β (IL-1β) 1x plate of 48 wells 373 € abebio human
AE58500GO-48 ELISA test for Goat Interleukin 1β (IL-1β) 1x plate of 48 wells 402 € abebio human
AE38400PI-48 ELISA test for Pig Interleukin 1β (IL-1β) 1x plate of 48 wells 326 € abebio human
AE38401RB-48 ELISA test for Rabbit Interleukin 1β (IL-1β) 1x plate of 48 wells 360 € abebio human
AE38399RA-48 ELISA test for Rat Interleukin 1β (IL-1β) 1x plate of 48 wells 272 € abebio human
AE58501FI Fish Interleukin 1β (IL-1β) ELISA Kit 96 wells plate 769 € ab-elisa elisas human
AE58501FI-96 Fish Interleukin 1β (IL-1β) ELISA Kit 1x plate of 96 wells 612 € abebio human
AE58500GO Goat Interleukin 1β (IL-1β) ELISA Kit 48 wells plate 500 € ab-elisa elisas human
AE58500GO-96 Goat Interleukin 1β (IL-1β) ELISA Kit 1x plate of 96 wells 671 € abebio human
6705 Mouse Interleukin-1beta (IL-1beta) Detection Assay Kit 1 assay kit or ELISA kit 444 € Chondrocytes and collagens mouse
AE38400PI-96 Pig Interleukin 1β (IL-1β) ELISA Kit 1x plate of 96 wells 519 € abebio human
AE38401RB Rabbit Interleukin 1β (IL-1β) ELISA Kit 48 wells plate 465 € ab-elisa elisas human
AE38401RB-96 Rabbit Interleukin 1β (IL-1β) ELISA Kit 1x plate of 96 wells 587 € abebio human
AE38399RA Rat Interleukin 1β (IL-1β) ELISA Kit 48 wells plate 358 € ab-elisa elisas human
AE38399RA-96 Rat Interleukin 1β (IL-1β) ELISA Kit 1x plate of 96 wells 410 € abebio human