Recombinant Human Tumor Necrosis Factor α, TNFα (N-6His)

Contact us
Catalog number: CG91
Price: 565 €
Supplier: adi
Product name: Recombinant Human Tumor Necrosis Factor α, TNFα (N-6His)
Quantity: 100 μg
Other quantities: 1 mg 2486€ 10 µg 202€ 500 µg 1755€
Related search:

More details :

Reacts with: Human
Source: proteins, Recombinants or rec
Description: Recombinant Human Tumor Necrosis Factor alpha is produced by our E, coli expression system and the target gene encoding Gly57-Leu233 is expressed with a 6His tag at the N-terminus
Molecular Weight: 21, 8 kD
UniProt number: P01375
State of the product: Freeze-dried
Shipping conditions: Ambient temperature
Formulation: pH 7, 100 mM sodium chloride, 2, 2 um filtered solution of 20 mM PB, Lyophilized from a 0
Storage recommendations: -20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at <
Reconstitution: Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml
Purity: and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid: MGSSHHHHHHSSGLVPRGSHMGPQREEFPRDLSLISPLAQAVRSSSRTPSDKPVAHVVANPQAEGQLQWLNRRANALLANGVELRDNQLVVPSEGLYLIYSQVLFKGQGCPSTHVLLTHTISRIAVSYQTKVNLLSAIKSPCQRETPEGAEAKPWYEPIYLGGVFQLEKGDRLSAEINRPDYLDFAESGQVYFGIIAL
Levels of endotoxin: 11 IEU/ug, LAL test shows less than than 0
Properties: Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp
Group: recombinants
Gene target: (N-6His), TNF&alpha, Tumor Necrosis Factor &alpha
Short name: (N-6His), TNF&alpha, Recombinant Tumor Necrosis Factor &alpha
Technique: E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Species: Humans
Alternative name: (N-6His), TNF&alpha, sapiens Tumor Necrosis Factor &alpha, recombinant H
Alternative technique: rec
Identity: 11892
Gene: TNF | More about : TNF
Long gene name: tumor necrosis factor
Synonyms gene: TNFA
Synonyms gene name: member 2) , tumor necrosis factor (TNF superfamily
Synonyms: TNFSF2 DIF TNF-alpha
Synonyms name: TNF superfamily, member 2
Locus: 6p21, 33
Discovery year: 1986-01-01
GenBank acession: X02910
Entrez gene record: 7124
Pubmed identfication: 2413547 6392892
Classification: Tumor necrosis factor superfamily
Havana BLAST/BLAT: OTTHUMG00000031194

Related Products :

CG90 Recombinant Human Tumor Necrosis Factor α, TNFα (C-6His) 10 µg 95 € novo human
CG91 Recombinant Human Tumor Necrosis Factor α, TNFα (N-6His) 1 mg 2486 € novo human
MBS617120 Tumor Necrosis Factor Receptor 1, p55/p60 (TNFR 1, CD120a, MGC19588, p55, p55 R, TNFR55, Tumor Necrosis Factor alpha Receptor, Tumor Necrosis Factor Binding Protein 1, TBP1, Tumor Necrosis Factor Receptor Superfamily Member 1A, TNFRSF1a) 100ug 868 € MBS Polyclonals_1 human
C008 Recombinant Human Tumor Necrosis Factor α, TNFα 1 mg 963 € novo human
YIAK3110.1 Tumor Necrosis Factor α (TNFα), Clone: tnfa9.9, Mouse Monoclonal antibody-Human; ELISA/RIA/WB 10 ug 153 € accurate-monoclonals human
YIAK3110.2 Tumor Necrosis Factor α (TNFα), Clone: tnfa9.9, Mouse Monoclonal antibody-Human; ELISA/RIA/WB 0.1mg 768 € accurate-monoclonals human
CF09 Recombinant Mouse Tumor Necrosis Factor, TNFα 10 µg 156 € novo human
MBS620184 TNF Receptor, Extracellular Domain p55 (TNFR 1, CD120a, MGC19588, p55, p55 R, TNFR55, Tumor Necrosis Factor alpha Receptor, Tumor Necrosis Factor Binding Protein 1, TBP1, Tumor Necrosis Factor Receptor Superfamily Member 1A, TNFRSF1a) Antibody 1000ug 685 € MBS Polyclonals_1 human
MBS621645 DR6 (Death Receptor 6, BM018, MGC31965, TNFR Related Death Receptor 6, Tumor Necrosis Factor Receptor Superfamily Member 21, Tumor Necrosis Factor Receptor Superfamily Member 21 Precursor, TNFRSF21) Antibody 100ug 564 € MBS Polyclonals_1 human
MBS619623 Tumor Necrosis Factor Receptor 1, p55/p60 (TNFR 1, TNFR1, TNF-R1, TNF-R, Tumor Necrosis Factor Receptor Type I, TNFR-I, TNF-RI, TNF-R-I, CD120a, FPF, MGC19588, p55, p55-R, p60, TBP1, TNFR55, TNF-R55, TNFR60, Tumor Necrosis Factor alpha Receptor, TNFAR, Tu Antibody 100ug 652 € MBS Polyclonals_1 human
MBS624468 Tumor Necrosis Factor Receptor 2, p75/p80 (TNFR 2, Tnfr2, Tnfr-2, TNF-R2, Tumor Necrosis Factor Receptor Type II, TNFRII, TNFR-II, TNF-RII, TNF-R-II, CD120b, p75, p80 TNF alpha Receptor, TNF-R75, TNFR80, TNFalpha-R2, TNF-alphaR2, Tumor Necrosis Factor bet 1 mililiter 1061 € MBS Polyclonals_1 human
C689 Recombinant Human Tumor Necrosis Factor Receptor I, TNFRSF1A, CD120a (N-6His) 10 µg 156 € novo human
CI39 Recombinant Human Tumor Necrosis Factor Receptor II, TNFRSF1B, CD120b (C-6His) 500 µg 1613 € novo human
C782 Recombinant Human Tumor Necrosis Factor Receptor II, TNFRSF1B, CD120b (Lys288-Ser461, C-6His) 10 µg 156 € novo human
C694 Recombinant Mouse Tumor Necrosis Factor Receptor II, TNFRSF1B, CD120b (C-6His) 500 µg 1613 € novo mouse
CS43 Recombinant Mouse Tumor Necrosis Factor Receptor Superfamily Member 5, CD40(C-6His) 10 µg 146 € novo mouse
MBS276474 TNFalpha-IP 2 antibody [C1C3] 100ul 426 € MBS Polyclonals_1 human
TNFA15-R-10 Recombinant (E.Coli) purified human Tumor Necrosis Factor-Alpha (TNF-alpha), biologically active 10 μg 260 € adi human
TNFA16-R-10 Recombinant (E.Coli) purified human Tumor Necrosis Factor-Alpha Variant (TNF-alpha variant, 151-aa), biologically active 10 μg 260 € adi human
C036 Recombinant Human Tumor Necrosis Factor-α, TNF-α High Active Mutant 10 µg 151 € novo human
TNFA35-R-5 Recombinant (E.Coli) purified mouse Tumor Necrosis Factor-Alpha (TNF-alpha), biologically active 5 μg 260 € adi human
TNFA36-R-5 Recombinant (E.Coli) purified porcine Tumor Necrosis Factor-Alpha (TNF-alpha), biologically active 5 μg 260 € adi human
TNFA25-R-5 Recombinant (E.Coli) purified rat Tumor Necrosis Factor-Alpha (TNF-alpha), biologically active 5 μg 260 € adi human
C082 Recombinant Rabbit Tumor Necrosis Factor α, TNF-α 10 µg 168 € novo human
RP-1796H Recombinant Human Tumor Necrosis Factor-alpha/TNFSF2 Protein 50µg 282 € adv human
GWB-903A93 Tumor Necrosis Factor- Alpha Human recombinant 1 vial 3986 € genways human
GWB-P0026M Tumor Necrosis Factor-alpha Human, Recombinant Protein bulk Ask price € genways bulk human
TNFA13-A Goat Anti-Human Tumor Necrosis Factor-Alpha (TNF-alpha) IgG #2, aff. Pure (neutralzing) 100 μL 565 € adi human
6801 Human Tumor Necrosis Factor Alpha (TNF-alpha) Detection Assay Kit 1 assay kit or ELISA kit 444 € Chondrocytes and collagens human
TNFA12-M Monoclonal Anti-Human Tumor Necrosis Factor-Alpha (TNF-alpha) 100 μg 565 € adi human