Recombinant Human 6-O-Methylguanine-DNA Methyltransferase, MGMT (N-6His)

Contact us
Catalog number: CG86
Price: 2150 €
Supplier: MBS Recombinant Proteins
Product name: Recombinant Human 6-O-Methylguanine-DNA Methyltransferase, MGMT (N-6His)
Quantity: 100ug
Other quantities: 1 mg 2283€ 10 µg 146€ 50 µg 339€
Related search:

More details :

Reacts with: Human
Source: proteins, Recombinants or rec
Description: Recombinant Human MGMT is produced by our E, coli expression system and the target gene encoding Met1-Asn207 is expressed with a 6His tag at the N-terminus
Molecular Weight: 23, 8 kD
UniProt number: P16455
State of the product: Liquid
Shipping conditions: Dry Ice/ice packs
Formulation: pH 8, 0 , 1 mM EDTA, 2 um filtered solution of 20 mMTrisHCl, Supplied as a 0
Storage recommendations: -20°, Please minimize freeze-thaw cycles, stable for 6 months after receipt, C, Store at <
Reconstitution: Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml
Purity: and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid: MGSSHHHHHHSSGLVPRGSHMDKDCEMKRTTLDSPLGKLELSGCEQGLHEIKLLGKGTSAADAVEVPAPAAVLGGPEPLMQCTAWLNAYFHQPEAIEEFPVPALHHPVFQQESFTRQVLWKLLKVVKFGEVISYQQLAALAGNPKAARAVGGAMRGNPVPILIPCHRVVCSSGAVGNYSGGLAVKEWLLAHEGHRLGKPGLGGSSGLAGAWLKGAGATSGSPPAGRN
Levels of endotoxin: 11 IEU/ug, LAL test shows less than than 0
Properties: Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp
Group: recombinants
Gene target: MGMT (N-6His), 6-O-Methylguanine-DNA Methyltransferase
Short name: MGMT (N-6His), Recombinant 6-O-Methylguanine-DNA Methyltransferase
Technique: E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Species: Humans, Human
Alternative name: O-6-methylguanine-Desoxyribonucleic acid methyltransferase (N-6His), sapiens 6-O-Methylguanine-Desoxyribonucleic acid Methyltransferase, recombinant H
Alternative technique: rec
Alternative to gene target: DNA-methyltransferase activity, MGMT and IDBG-93188 and ENSG00000170430 and 4255, Mgmt and IDBG-211408 and ENSMUSG00000054612 and 17314, nuclei, this GO :0003677 and DNA binding and molecular function this GO :0003824 and catalytic activity and molecular function this GO :0003908 and methylated-DNA-[protein]-cysteine S-methyltransferase activity and molecular function this GO :0005509 and calcium ion binding and molecular function this GO :0005634 and nucleus and cellular component this GO :0005654 and nucleoplasm and cellular component this GO :0006266 and DNA ligation and biological process this GO :0006281 and DNA repair and biological process this GO :0006306 and DNA methylation and biological process this GO :0006307 and DNA dealkylation involved in DNA repair and biological process this GO :0006974 and cellular response to DNA damage stimulus and biological process this GO :0008168 and methyltransferase activity and molecular function this GO :0009008 and DNA-methyltransferase activity and molecular function this GO :0009636 and response to toxic substance and biological process this GO :0014070 and response to organic cyclic compound and biological process this GO :0016020 and membrane and cellular component this GO :0034599 and cellular response to oxidative stress and biological process this GO :0042493 and response to drug and biological process this GO :0043281 and regulation of cysteine-type endopeptidase activity involved in apoptotic process and biological process this GO :0045471 and response to ethanol and biological process this GO :0045739 and positive regulation of DNA repair and biological process this GO :0051593 and response to folic acid and biological process this GO :0060548 and negative regulation of cell death and biological process this GO :0060644 and mammary gland epithelial cell differentiation and biological process this GO :0071407 and cellular response to organic cyclic compound and biological process this GO :0071479 and cellular response to ionizing radiation and biological process, this GO :0003677 : DNA binding, this GO :0003677 : DNA binding and also this GO :0003824 : catalytic activity and also this GO :0003908 : methylated-DNA-[protein]-cysteine S-methyltransferase activity and also this GO :0005509 : calcium ion binding and also this GO :0008168 : methyltransferase activity and also this GO :0009008 : DNA-methyltransferase activity, this GO :0003824 : catalytic activity, this GO :0003908 : methylated-DNA-[protein]-cysteine S-methyltransferase activity, this GO :0005509 : calcium ion binding, this GO :0008168 : methyltransferase activity, this GO :0009008 : DNA-methyltransferase activity, O-6-methylguanine-DNA methyltransferase
Identity: 7059
Gene: MGMT | More about : MGMT
Long gene name: O-6-methylguanine-DNA methyltransferase
Synonyms name: methylated-DNA--protein-cysteine methyltransferase
Locus: 10q26, 3
Discovery year: 1989-10-16
GenBank acession: M29971
Entrez gene record: 4255
RefSeq identity: NM_002412
Havana BLAST/BLAT: OTTHUMG00000019261

Related Products :

CG86 Recombinant Human 6-O-Methylguanine-DNA Methyltransferase, MGMT (N-6His) 10 µg 146 € novo human
MGMT15-R-10 Recombinant, purified, Human O6-methylguanine-DNA-Methyl transferase (MGMT) protein (active) 10 μg 768 € adi human
MGMT15-R-5 Recombinant, purified, Human O6-methylguanine-DNA-Methyl transferase (MGMT) protein (active) 5 μg 478 € adi human
MGMT11-C Recombinant, purified, Human O6-methylguanine-DNA-Methyl transferase (MGMT) protein control for WB 100 μL 333 € adi human
MGMT12-C Recombinant, purified, Human O6-methylguanine-DNA-Methyl transferase (MGMT) protein control for WB 100 μL 333 € adi human
DL-MGMT-Hu Human O-6-Methylguanine DNA Methyltransferase MGMT ELISA Kit 96T 904 € DL elisas human
BMDV10125 MGMT (O6-methylguanine-DNA methyltransferase), 25kD, Clone: MT 3.1, Mouse Monoclonal antibody-Human, X weakly w/Mouse, Rat & Hamster; paraffin, IH/WB 500ul 887 € accurate-monoclonals hamster
MBS615819 MGMT (O6-Methylguanine DNA Methyltransferase) 50ug 625 € MBS Polyclonals_1 human
MBS615863 MGMT (O6-methylguanine-DNA methyltransferase) Antibody 0.05 ml 442 € MBS Polyclonals_1 human
MBS616054 MGMT (O6-Methylguanine DNA Methyltransferase) Antibody 100ul 536 € MBS Polyclonals_1 human
EKU06379 O-6-Methylguanine DNA Methyltransferase (MGMT) ELISA kit 1 plate of 96 wells 822 € Biomatik ELISA kits human
EKU06380 O-6-Methylguanine DNA Methyltransferase (MGMT) ELISA kit 1 plate of 96 wells 888 € Biomatik ELISA kits human
DL-MGMT-Ra Rat O-6-Methylguanine DNA Methyltransferase MGMT ELISA Kit 96T 962 € DL elisas rat
MGMT11-S Rabbit Anti-Human Human O6-methylguanine-DNA-Methyl transferase (MGMT) protein antiserum #1 100 μL 536 € adi human
GWB-FCDDEB Recombinant Human O-6-Methylguanine-DNA Methyltransferase bulk Ask price € genways bulk human
abx168236 Anti-O-6-Methylguanine DNA Methyltransferase Protein (Recombinant) 100 μg 862 € abbex human
abx168529 Anti-O-6-Methylguanine DNA Methyltransferase Protein (Recombinant) 100 μg 905 € abbex human
abx129084 Anti-O-6-Methylguanine DNA Methyltransferase Antibody 50 μg 412 € abbex human
abx130409 Anti-O-6-Methylguanine DNA Methyltransferase Antibody 10 μg 282 € abbex human
GENTAUR-58b8e52bd779e Human Methylated-DNA--protein-cysteine methyltransferase (MGMT) 100ug 1630 € MBS Recombinant Proteins human
GENTAUR-58b8e52c43a45 Human Methylated-DNA--protein-cysteine methyltransferase (MGMT) 1000ug 1630 € MBS Recombinant Proteins human
GENTAUR-58b8e52cd6cb9 Human Methylated-DNA--protein-cysteine methyltransferase (MGMT) 100ug 2144 € MBS Recombinant Proteins human
GENTAUR-58b8e52d54c13 Human Methylated-DNA--protein-cysteine methyltransferase (MGMT) 1000ug 2144 € MBS Recombinant Proteins human
GENTAUR-58b9e14baa02e Human Methylated-DNA--protein-cysteine methyltransferase (MGMT) 100ug 1630 € MBS Recombinant Proteins human
GENTAUR-58b9e14c01ce6 Human Methylated-DNA--protein-cysteine methyltransferase (MGMT) 1000ug 1630 € MBS Recombinant Proteins human
GENTAUR-58b9e14c80129 Human Methylated-DNA--protein-cysteine methyltransferase (MGMT) 100ug 2144 € MBS Recombinant Proteins human
GENTAUR-58b9e14cef973 Human Methylated-DNA--protein-cysteine methyltransferase (MGMT) 1000ug 2144 € MBS Recombinant Proteins human
GENTAUR-58bc687320151 Cricetulus griseus Methylated-DNA--protein-cysteine methyltransferase (MGMT) 100ug 1636 € MBS Recombinant Proteins human
GENTAUR-58bc6873682a2 Cricetulus griseus Methylated-DNA--protein-cysteine methyltransferase (MGMT) 1000ug 1636 € MBS Recombinant Proteins human
GENTAUR-58bc6873b21bb Cricetulus griseus Methylated-DNA--protein-cysteine methyltransferase (MGMT) 100ug 2150 € MBS Recombinant Proteins human