| Reacts with: |
Human |
| Source: |
proteins, Recombinants or rec |
| Description: |
Recombinant Human MGMT is produced by our E, coli expression system and the target gene encoding Met1-Asn207 is expressed with a 6His tag at the N-terminus |
| Molecular Weight: |
23, 8 kD |
| UniProt number: |
P16455 |
| State of the product: |
Liquid |
| Shipping conditions: |
Dry Ice/ice packs |
| Formulation: |
pH 8, 0 , 1 mM EDTA, 2 um filtered solution of 20 mMTrisHCl, Supplied as a 0 |
| Storage recommendations: |
-20°, Please minimize freeze-thaw cycles, stable for 6 months after receipt, C, Store at < |
| Reconstitution: |
Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml |
| Purity: |
and determined by Polyacrylamide gel electrophoresis, Greater than 95% |
| Sequence of the amino acid: |
MGSSHHHHHHSSGLVPRGSHMDKDCEMKRTTLDSPLGKLELSGCEQGLHEIKLLGKGTSAADAVEVPAPAAVLGGPEPLMQCTAWLNAYFHQPEAIEEFPVPALHHPVFQQESFTRQVLWKLLKVVKFGEVISYQQLAALAGNPKAARAVGGAMRGNPVPILIPCHRVVCSSGAVGNYSGGLAVKEWLLAHEGHRLGKPGLGGSSGLAGAWLKGAGATSGSPPAGRN |
| Levels of endotoxin: |
11 IEU/ug, LAL test shows less than than 0 |
| Properties: |
Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine, , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp |
| Group: |
recombinants |
| Gene target: |
MGMT (N-6His), 6-O-Methylguanine-DNA Methyltransferase |
| Short name: |
MGMT (N-6His), Recombinant 6-O-Methylguanine-DNA Methyltransferase |
| Technique: |
E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli |
| Species: |
Humans, Human |
| Alternative name: |
O-6-methylguanine-Desoxyribonucleic acid methyltransferase (N-6His), sapiens 6-O-Methylguanine-Desoxyribonucleic acid Methyltransferase, recombinant H |
| Alternative technique: |
rec |
| Alternative to gene target: |
DNA-methyltransferase activity, MGMT and IDBG-93188 and ENSG00000170430 and 4255, Mgmt and IDBG-211408 and ENSMUSG00000054612 and 17314, nuclei, this GO :0003677 and DNA binding and molecular function this GO :0003824 and catalytic activity and molecular function this GO :0003908 and methylated-DNA-[protein]-cysteine S-methyltransferase activity and molecular function this GO :0005509 and calcium ion binding and molecular function this GO :0005634 and nucleus and cellular component this GO :0005654 and nucleoplasm and cellular component this GO :0006266 and DNA ligation and biological process this GO :0006281 and DNA repair and biological process this GO :0006306 and DNA methylation and biological process this GO :0006307 and DNA dealkylation involved in DNA repair and biological process this GO :0006974 and cellular response to DNA damage stimulus and biological process this GO :0008168 and methyltransferase activity and molecular function this GO :0009008 and DNA-methyltransferase activity and molecular function this GO :0009636 and response to toxic substance and biological process this GO :0014070 and response to organic cyclic compound and biological process this GO :0016020 and membrane and cellular component this GO :0034599 and cellular response to oxidative stress and biological process this GO :0042493 and response to drug and biological process this GO :0043281 and regulation of cysteine-type endopeptidase activity involved in apoptotic process and biological process this GO :0045471 and response to ethanol and biological process this GO :0045739 and positive regulation of DNA repair and biological process this GO :0051593 and response to folic acid and biological process this GO :0060548 and negative regulation of cell death and biological process this GO :0060644 and mammary gland epithelial cell differentiation and biological process this GO :0071407 and cellular response to organic cyclic compound and biological process this GO :0071479 and cellular response to ionizing radiation and biological process, this GO :0003677 : DNA binding, this GO :0003677 : DNA binding and also this GO :0003824 : catalytic activity and also this GO :0003908 : methylated-DNA-[protein]-cysteine S-methyltransferase activity and also this GO :0005509 : calcium ion binding and also this GO :0008168 : methyltransferase activity and also this GO :0009008 : DNA-methyltransferase activity, this GO :0003824 : catalytic activity, this GO :0003908 : methylated-DNA-[protein]-cysteine S-methyltransferase activity, this GO :0005509 : calcium ion binding, this GO :0008168 : methyltransferase activity, this GO :0009008 : DNA-methyltransferase activity, O-6-methylguanine-DNA methyltransferase |
| Identity: |
7059 |
| Gene: |
MGMT |
More about : MGMT |
| Long gene name: |
O-6-methylguanine-DNA methyltransferase |
| Synonyms name: |
methylated-DNA--protein-cysteine methyltransferase |
| Locus: |
10q26, 3 |
| Discovery year: |
1989-10-16 |
| GenBank acession: |
M29971 |
| Entrez gene record: |
4255 |
| RefSeq identity: |
NM_002412 |
| Havana BLAST/BLAT: |
OTTHUMG00000019261 |