Recombinant Human Nucleolar Protein Family A Member 2, NHP2, NOLA2 (N-6His)

Contact us
Catalog number: CG85
Price: 1613 €
Supplier: novo
Product name: Recombinant Human Nucleolar Protein Family A Member 2, NHP2, NOLA2 (N-6His)
Quantity: 500 µg
Other quantities: 1 mg 2283€ 50 µg 339€ 500 µg 1613€
Related search:

More details :

Reacts with: Human
Source: proteins, Recombinants or rec
Description: Recombinant Human NHP2 is produced by our E, coli expression system and the target gene encoding Met1-Leu153 is expressed with a 6His tag at the N-terminus
Molecular Weight: 19, 3 kD
UniProt number: Q9NX24
State of the product: Liquid
Shipping conditions: Dry Ice/ice packs
Formulation: pH 8, 1 mM DTT, 100 mM sodium chloride, 2 um filtered solution of 20 mM Tris, Supplied as a 0
Storage recommendations: -20°, Please minimize freeze-thaw cycles, stable for 6 months after receipt, C, Store at <
Reconstitution: Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml
Purity: and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid: MGSSHHHHHHSSGLVPRGSHMTKIKADPDGPEAQAEACSGERTYQELLVNQNPIAQPLASRRLTRKLYKCIKKAVKQKQIRRGVKEVQKFVNKGEKGIMVLAGDTLPIEVYCHLPVMCEDRNLPYVYIPSKTDLGAAAGSKRPTCVIMVKPHEEYQEAYDECLEEVQSLPLPL
Levels of endotoxin: 11 IEU/ug, LAL test shows less than than 0
Properties: Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp
Group: recombinants
Gene target: NHP2, NOLA2 (N-6His), Nucleolar Protein Family A Member 2
Short name: NHP2, NOLA2 (N-6His), Recombinant Nucleolar Protein Family A Member 2
Technique: E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Species: Humans, Human
Alternative name: NHP2, NOLA2 (N-6His), sapiens Nucleolar Protein family A Member 2, recombinant H
Alternative technique: rec
Identity: 14377
Gene: NHP2 | More about : NHP2
Long gene name: NHP2 ribonucleoprotein
Synonyms gene: NOLA2
Synonyms gene name: member 2 (H/ACA small nucleolar RNPs) NHP2 ribonucleoprotein homolog (yeast) , nucleolar protein family A
Synonyms: FLJ20479
Locus: 5q35, 3
Discovery year: 2001-02-06
GenBank acession: AF161404
Entrez gene record: 55651
Pubmed identfication: 11074001
RefSeq identity: NM_017838
Classification: H/ACA ribonucleoprotein complex
Havana BLAST/BLAT: OTTHUMG00000130886
Locus Specific Databases: LRG_346

Related Products :

CG85 Recombinant Human Nucleolar Protein Family A Member 2, NHP2, NOLA2 (N-6His) 50 µg 339 € novo human
MBS615544 Nucleophosmin (NPM, B23, MGC104254, NO38, Nucleolar Phosphoprotein B23, Nucleolar Protein NO38, Nucleophosmin/B23.2, Nucleoplasmin Family Member 1, NPM1, Numatrin, TRK Fused Gene) 100ug 735 € MBS Polyclonals_1 human
C240 Recombinant Human NHP2-Like Protein 1, NHP2L1 (N-6His) 500 µg 1613 € novo human
AR09805PU-L anti-NOLA2 (1-153, His-tag) Antibody 0,5 mg 1500 € acr human
AR09805PU-N anti-NOLA2 (1-153, His-tag) Antibody 0,1 mg 587 € acr human
MBS624593 E2IG3, CT (Nucleostemin, Guanine Nucleotide-binding Protein-Like 3, Nucleolar GTP-binding Protein 3, E2-induced Gene 3 Protein, Novel Nucleolar Protein 47, NNP47, NS) Antibody 200ul 603 € MBS Polyclonals_1 human
MBS619768 Nucleolar Protein, 30kD (Nop30, Apoptosis Repressor with CARD, ARC, Muscle-enriched Cytoplasmic Protein, Myp, Nucleolar Protein 3) 100ug 575 € MBS Polyclonals_1 human
MBS624584 NPM1, NT (Nucleophosmin, NPM, Nucleolar Phosphoprotein B23, Numatrin, Nucleolar Protein NO38, NPM) Antibody 200ul 603 € MBS Polyclonals_1 human
MBS624379 WASF3 (Wiskott-Aldrich Syndrome Protein Family Member 3, WASP Family Protein Member 3, Protein WAVE-3, Verprolin Homology Domain-containing Protein 3, KIAA0900, SCAR3, WAVE3) Antibody 100ug 658 € MBS Polyclonals_1 human
MBS623297 WIPF1 (WAS/WASL interacting protein family, Member 1, MGC111041, PRPL-2, PRPL-2 protein, WAS/WASL interacting protein family member 1, WASP-interacting protein, WASPIP, WIP, Wiskott-Aldrich syndrome protein interacting protein, Wiskott-Aldrich syndrome pr Antibody 100ug 591 € MBS Polyclonals_1 human
MBS623700 CKIP-1, NT (Pleckstrin Homology Domain-containing Family O Member 1, PH Domain-containing Family O Member 1, Casein Kinase 2-interacting Protein 1, CK2-interacting Protein 1, CKIP-1, C-Jun-binding Protein, JBP, Osteoclast Maturation-associated Gene 120 Pr Antibody 200ul 603 € MBS Polyclonals_1 human
MBS613943 MRP4 (Multidrug Resistance-associated Protein 4, ATP-binding Cassette Sub-family C (CFTR/MRP) Member 4, ATP Binding Cassette Sub-family C Member 4, ABCC4, bA464I2.1, Canalicular Multispecific Organic Anion Transporter ABC Superfamily, Canalicular Multispe 100ug 735 € MBS Polyclonals_1 human
MBS619621 MRP5 (Multidrug Resistance-associated Protein 5, ABC33, ATP-binding Cassette Sub-family C (CFTR/MRP) Member 5, ATP Binding Cassette Sub-family C Member 5, ABCC5, Canalicular Multispecific Organic Anion Transporter C, DKFZp686C1782, EST277145, Multispecifi 100ug 735 € MBS Polyclonals_1 human
MBS623141 Zic1 (Zinc Finger Protein of the Cerebellum 1, Zic Family Member 1 (Odd-paired Drosophila Homolog), Zic Family Member 1, Zic 1, Zic-1, ZIC, Odd Paired Homolog Drosophila, Zinc Finger Protein ZIC 1, Zinc Finger Protein ZIC1, ZNF201) 100ul 630 € MBS Polyclonals_1 drosophila
MBS620240 ABCA4 (ATP Binding Cassette Sub-family A Member 4, ATP-binding Cassette Sub-family A (ABC1) Member 4, ABCA 4, ABCR, ARMD 2, ARMD2, ATP Binding Cassette 10, ABC10, ATP-binding Transporter Retina Specific, CORD3, FFM, Photoreceptor Rim Protein, Retina-speci 100ug 509 € MBS Polyclonals_1 human
MBS619325 ABCB10 (ABCB10 ATP Binding Cassette, Sub-family B (MDR/TAP) Member 10, ATP-binding Cassette Sub-family B Member 10 Mitochondrial, ABCB 10, ATP-binding Cassette Transporter 10, ABC Transporter 10 Protein, EST20237, Mitochondrial ATP Binding Cassette 2, M A Antibody 100ug 707 € MBS Polyclonals_1 human
MBS620422 ABCB10 (ABCB10 ATP Binding Cassette, Sub-family B (MDR/TAP) Member 10, ATP-binding Cassette Sub-family B Member 10 Mitochondrial, ATP-binding Cassette Transporter 10, ABC Transporter 10 Protein, EST20237, Mitochondrial ATP Binding Cassette 2, M ABC2, M-AB 100ug 509 € MBS Polyclonals_1 human
MBS619748 Aldehyde Dehydrogenase Family 3, Member A2 (Aldh3A2, Aldehyde dehydrogenase, microsomal, Aldehyde dehydrogenase 10, Aldehyde dehydrogenase family 3 member A2, ALDH10, DKFZp686E23276, FALDH, Fatty aldehyde dehydrogenase, FLJ20851, SLS) Antibody 100ug 536 € MBS Polyclonals_1 human
MBS619554 aldo keto reductase family 1, member C2 (AKR1C2, 3-alpha-HSD3, AKR1C-pseudo, Aldo-keto reductase family 1 member C2, BABP, Chlordecone reductase homolog HAKRD, DD, DD/BABP, DD2, DDH2, Dihydrodiol dehydrogenase/bile acid-binding protein, Dihydrodiol dehydr Antibody 0.04 mg 370 € MBS Polyclonals_1 human
MBS624084 CFTR/MRP, (ATP-Binding Cassette, sub-family C, Member 13, PRED6, ABCC13 ATP-binding cassette, sub-family C (CFTR/MRP), member 13, pseudogene) Antibody 100ug 509 € MBS Polyclonals_1 human
MBS621617 Solute Carrier Family 12a3 (Slc12a3, Sodium/chloride transporters, member 3, Na-Cl symporter, NCC, Solute carrier family 12 member 3, Thiazide- sensitive sodium-chloride cotransporter, Tsc, TSC) 100ul 641 € MBS Polyclonals_1 human
MBS621227 Urea Transporter A1 (Slc14a2. Solute carrier family 14 (urea transporter), member 2, Slc14a2T, Solute carrier family 14 member 2, Urea transporter, kidney, Urea transporter 2, UrT1-C, UrT1-D, Ut2) Antibody 100ul 641 € MBS Polyclonals_1 human
MBS611694 VGAT (solute carrier family 32 (GABA vesicular transporter) member 1, GABA and glycine transporter, SLC32A 1, Solute carrier family 32 member 1, VGAT, VIAAT, Vesicular GABA Amino Acid Transporter, Vesicular GABA transporter, Vesicular inhibitory amino aci 50ug 685 € MBS Polyclonals_1 human
CA31 Recombinant Human Chymotrypsin-Like Elastase Family Member 3A, CELA3A (C-6His) 500 µg 1613 € novo human
CA38 Recombinant Human Linker for Activation of T-Cells Family Member 2, LAT2 (C-6His) 1 mg 2283 € novo human
CB90 Recombinant Human SLAM Family Member 2, CD48 (C-Fc-6His) 10 µg 146 € novo human
CS60 Recombinant Human SLAM Family Member 5, SLAMF5, CD84(C-6His) 1 mg 1674 € novo human
C387 Recombinant Human SLAM Family Member 6, SLAMF6, CD352, NTB-A (C-6His) 10 µg 121 € novo human
C316 Recombinant Human SLAM Family Member 7, SLAMF7, CD319, CRACC (C-6His) 500 µg 1613 € novo human
C771 Recombinant Human SLAM Family Member 8, BLAME, SLAMF8, BLAME (C-6His) 500 µg 1613 € novo human