Recombinant Human Unique Cartilage Matrix-Associated Protein, UCMA

Contact us
Catalog number: CG76
Price: Ask price €
Supplier: accurate-monoclonals
Product name: Recombinant Human Unique Cartilage Matrix-Associated Protein, UCMA
Quantity: 2 ml
Other quantities: 10 µg 202€ 50 µg 496€ 500 µg 1755€
Related search:

More details :

Reacts with: Human
Source: proteins, Recombinants or rec
Description: Recombinant Human Unique cartilage matrix-associated protein is produced by our E, coli expression system and the target gene encoding Ser65-Thr138 is expressed
Molecular Weight: 76 kD, 9
UniProt number: Q8WVF2
State of the product: Liquid
Shipping conditions: Dry Ice/ice packs
Formulation: 2 um filtered solution of 20 mM PB,150 mM sodium chloride, 4, Supplied as a 0, pH7
Storage recommendations: -20°, Please minimize freeze-thaw cycles, stable for 6 months after receipt, C, Store at <
Reconstitution: Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml
Purity: and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid: GHMSPKSRDEVNVENRQKLRVDELRREYYEEQRNEFENFVEEQNDEQEERSREAVEQWRQWHYDGLHPSYLYNRHHT
Levels of endotoxin: 11 IEU/ug, LAL test shows less than than 0
Properties: Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp
Group: recombinants
Gene target: UCMA, Unique Cartilage Matrix-Associated Protein
Short name: UCMA, Recombinant Unique Cartilage Matrix-Associated Protein
Technique: E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Species: Humans, Human
Alternative name: UCMA, sapiens Unique Cartilage Matrix-Associated Protein, recombinant H
Alternative technique: rec
Identity: 25205
Gene: UCMA | More about : UCMA
Long gene name: upper zone of growth plate and cartilage matrix associated
Synonyms gene: C10orf49
Synonyms gene name: chromosome 10 open reading frame 49
Locus: 10p13
Discovery year: 2004-05-27
GenBank acession: BC018068
Entrez gene record: 221044
Pubmed identfication: 12477932
RefSeq identity: NM_145314
Havana BLAST/BLAT: OTTHUMG00000017692

Related Products :

CG76 Recombinant Human Unique Cartilage Matrix-Associated Protein, UCMA 50 µg 496 € novo human
GENTAUR-58ba16562c54a Acipenser naccarii Unique cartilage matrix-associated protein (ucma) 100ug 1398 € MBS Recombinant Proteins human
GENTAUR-58ba1656d48b6 Acipenser naccarii Unique cartilage matrix-associated protein (ucma) 1000ug 1398 € MBS Recombinant Proteins human
GENTAUR-58ba16577e6f3 Acipenser naccarii Unique cartilage matrix-associated protein (ucma) 100ug 1901 € MBS Recombinant Proteins human
GENTAUR-58ba16583287b Acipenser naccarii Unique cartilage matrix-associated protein (ucma) 1000ug 1901 € MBS Recombinant Proteins human
GENTAUR-58bab06c726bc Dicentrarchus labrax Unique cartilage matrix-associated protein (ucma) 100ug 1387 € MBS Recombinant Proteins human
GENTAUR-58bab06cd498d Dicentrarchus labrax Unique cartilage matrix-associated protein (ucma) 1000ug 1387 € MBS Recombinant Proteins human
GENTAUR-58bab06d7d778 Dicentrarchus labrax Unique cartilage matrix-associated protein (ucma) 100ug 1890 € MBS Recombinant Proteins human
GENTAUR-58bab06e35978 Dicentrarchus labrax Unique cartilage matrix-associated protein (ucma) 1000ug 1890 € MBS Recombinant Proteins human
GENTAUR-58bd1c79eeb70 Rat Unique cartilage matrix-associated protein (Ucma) 100ug 1398 € MBS Recombinant Proteins rat
GENTAUR-58bd1c7a380e5 Rat Unique cartilage matrix-associated protein (Ucma) 1000ug 1398 € MBS Recombinant Proteins rat
GENTAUR-58bd1c7ab9552 Rat Unique cartilage matrix-associated protein (Ucma) 100ug 1901 € MBS Recombinant Proteins rat
GENTAUR-58bd1c7b07af9 Rat Unique cartilage matrix-associated protein (Ucma) 1000ug 1901 € MBS Recombinant Proteins rat
GENTAUR-58b86c6ab2fc3 Sparus aurata Unique cartilage matrix-associated protein (ucma) 100ug 1387 € MBS Recombinant Proteins human
GENTAUR-58b86c6b3773a Sparus aurata Unique cartilage matrix-associated protein (ucma) 1000ug 1387 € MBS Recombinant Proteins human
GENTAUR-58b86c6ba2040 Sparus aurata Unique cartilage matrix-associated protein (ucma) 100ug 1890 € MBS Recombinant Proteins human
GENTAUR-58b86c6c265d9 Sparus aurata Unique cartilage matrix-associated protein (ucma) 1000ug 1890 € MBS Recombinant Proteins human
GENTAUR-58bd81544fb0f Xenopus tropicalis Unique cartilage matrix-associated protein (ucma) 100ug 1398 € MBS Recombinant Proteins xenopus
GENTAUR-58bd8154c38a8 Xenopus tropicalis Unique cartilage matrix-associated protein (ucma) 1000ug 1398 € MBS Recombinant Proteins xenopus
GENTAUR-58bd815528d14 Xenopus tropicalis Unique cartilage matrix-associated protein (ucma) 100ug 1901 € MBS Recombinant Proteins xenopus
GENTAUR-58bd81558d84f Xenopus tropicalis Unique cartilage matrix-associated protein (ucma) 1000ug 1901 € MBS Recombinant Proteins xenopus
abx257430 Anti-Human Unique cartilage matrix-associated protein ELISA Kit inquire 50 € abbex human
MBS621006 West Nile Virus, Matrix (West Nile Virus Matrix Protein, WNV Matrix Protein, Envelope Protein M, Matrix Protein, West Nile Virus Envelope Protein M) 100ug 658 € MBS Polyclonals_1 virus
MBS620959 West Nile Virus, Matrix (West Nile Virus Matrix Protein, WNV Matrix Protein, Envelope Protein M, Matrix Protein, West Nile Virus Envelope Protein M) Antibody 100ug 857 € MBS Polyclonals_1 virus
abx262574 Anti-Cartilage Oligomeric Matrix Protein, HEK Protein (Recombinant) 1 mg 6662 € abbex human
abx166151 Anti-Cartilage Oligomeric Matrix Protein (Recombinant) 50 μg 572 € abbex human
MBS621802 SMARCC1 (SWI/SNF-related Matrix-associated Actin-dependent Regulator of Chromatin C1, SWI/SNF-related Matrix-associated Actin-dependent Regulator of Chromatin Subfamily C Member 1, SMARC-C1, AI115498, BRG1-associated Factor 155, BAF155, Chromatin Remodeli Antibody 100ul 785 € MBS Polyclonals_1 human
abx190186 Anti-Human Cartilage Oligomeric Matrix Protein CLIA Kit 96 tests 1079 € abbex human
abx250232 Anti-Human Cartilage oligomeric matrix protein ELISA Kit 96 tests 557 € abbex human
OBT0283 Cartilage Oligomeric Matrix Protein (COMP), Clone: MA37C94 (HC484D1), Rat Mouse Monoclonal antibody-Human; frozen/paraffin, IH/ELISA/IP 2 ml Ask price € accurate-monoclonals human