| Reacts with: |
Human |
| Source: |
proteins, Recombinants or rec |
| Description: |
Recombinant Human Zinc Finger HIT Domain-Containing Protein 1 is produced by our E, coli expression system and the target gene encoding Met1-Val154 is expressed with a 6His tag at the N-terminus |
| Molecular Weight: |
19, 6 kD |
| UniProt number: |
O43257 |
| State of the product: |
Liquid |
| Shipping conditions: |
Dry ice/ice packs |
| Formulation: |
2 um filtered solution of 20 mM PB，150 mM sodium chloride，50% Glycerol, 4, Supplied as a 0, pH7 |
| Storage recommendations: |
-20°, Please minimize freeze-thaw cycles, stable for 6 months after receipt, C, Store at < |
| Reconstitution: |
Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml |
| Purity: |
and determined by Polyacrylamide gel electrophoresis, Greater than 95% |
| Sequence of the amino acid: |
MGSSHHHHHHSSGLVPRGSHMVEKKTSVRSQDPGQRRVLDRAARQRRINRQLEALENDNFQDDPHAGLPQLGKRLPQFDDDADTGKKKKKTRGDHFKLRFRKNFQALLEEQNLSVAEGPNYLTACAGPPSRPQRPFCAVCGFPSPYTCVSCGARYCTVRCLGTHQETRCLKWTV |
| Levels of endotoxin: |
11 IEU/ug, LAL test shows less than than 0 |
| Properties: |
Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine, , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp |
| Group: |
recombinants |
| Gene target: |
ZNFN4A1 (N-6His), ZNHIT1, Zinc Finger HIT Domain Protein 1 |
| Short name: |
ZNFN4A1 (N-6His), ZNHIT1, Recombinant Zinc Finger HIT Domain- Protein 1 |
| Technique: |
E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli |
| Species: |
Humans, Human |
| Alternative name: |
ZNFN4A1 (N-6His), ZNHIT1, sapiens Zinc Finger HIT Domain-Containing Protein 1, recombinant H |
| Alternative technique: |
rec |
| Identity: |
21688 |
| Gene: |
ZNHIT1 |
More about : ZNHIT1 |
| Long gene name: |
zinc finger HIT-type containing 1 |
| Synonyms gene: |
ZNFN4A1 |
| Synonyms gene name: |
HIT domain containing 1 , member 1 zinc finger, subfamily 4A (HIT domain containing), zinc finger protein |
| Synonyms: |
CG1I H_DJ0747G18, 14 |
| Synonyms name: |
putative cyclin G1 interacting protein |
| Locus: |
7q22, 1 |
| Discovery year: |
2003-07-14 |
| GenBank acession: |
AF093571 |
| Entrez gene record: |
10467 |
| RefSeq identity: |
NM_006349 |
| Classification: |
Zinc fingers HIT-type SRCAP complex |
| Havana BLAST/BLAT: |
OTTHUMG00000157113 |