Recombinant Human Calreticulin-3, CALR3, CRT2

Contact us
Catalog number: CG66
Price: 402 €
Supplier: abebio
Product name: Recombinant Human Calreticulin-3, CALR3, CRT2
Quantity: 1x plate of 48 wells
Other quantities: 1 mg 2283€ 10 µg 146€ 500 µg 1613€
Related search:

More details :

Reacts with: Human
Source: proteins, Recombinants or rec
Description: Recombinant Human calreticulin-3 is produced by our E, coli expression system and the target gene encoding Thr20-Leu384 is expressed
Molecular Weight: 42, 9 kD
UniProt number: Q96L12
State of the product: Freeze-dried
Shipping conditions: Ambient temperature
Formulation: 2 um filtered solution of 20 mM PB,150 mM sodium chloride, 4, Lyophilized from a 0, pH7
Storage recommendations: -20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at <
Reconstitution: Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml
Purity: and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid: MTVYFQEEFLDGEHWRNRWLQSTNDSRFGHFRLSSGKFYGHKEKDKGLQTTQNGRFYAISARFKPFSNKGKTLVIQYTVKHEQKMDCGGGYIKVFPADIDQKNLNGKSQYYIMFGPDICGFDIKKVHVILHFKNKYHENKKLIRCKVDGFTHLYTLILRPDLSYDVKIDGQSIESGSIEYDWNLTSLKKETSPAESKDWEQTKDNKAQDWEKHFLDASTSKQSDWNGDLDGDWPAPMLQKPPYQDGLKPEGIHKDVWLHRKMKNTDYLTQYDLSEFENIGAIGLELWQVRSGTIFDNFLITDDEEYADNFGKATWGETKGPEREMDAIQAKEEMKKAREEEEEELLSGKINRHEHYFNQFHRRNEL
Levels of endotoxin: 11 IEU/ug, LAL test shows less than than 0
Properties: Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp
Group: recombinants
Gene target: CALR3, CRT2, Calreticulin-3
Short name: CALR3, CRT2, Recombinant Calreticulin-3
Technique: E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Species: Humans, Human
Alternative name: CALR3, CRT2, sapiens Calreticulin-3, recombinant H
Alternative technique: rec
Identity: 20407
Gene: CALR3 | More about : CALR3
Long gene name: calreticulin 3
Synonyms: CRT2 FLJ25355 MGC26577 CT93
Synonyms name: cancer/testis antigen 93 calsperin
Locus: 19p13, 11
Discovery year: 2003-02-04
GenBank acession: AK058084
Entrez gene record: 125972
Pubmed identfication: 12384296
RefSeq identity: NM_145046
Havana BLAST/BLAT: OTTHUMG00000152571
Locus Specific Databases: LRG_422

Related Products :

CG66 Recombinant Human Calreticulin-3, CALR3, CRT2 10 µg 146 € novo human
GWB-ATG0AF CALR3, 20-384aa Human, His tag, E.coli bulk Ask price € genways bulk human
LV105856 CALR3 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV) 1.0 µg DNA 322 € ABM lentivectors human
LV105857 CALR3 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-C-term-HA) 1.0 µg DNA 322 € ABM lentivectors human
LV105858 CALR3 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro) 1.0 µg DNA 322 € ABM lentivectors human
LV105859 CALR3 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro) 1.0 µg DNA 322 € ABM lentivectors human
LV105861 CALR3 Lentiviral Vector (Human) (EF1a) (pLenti-GIII-EF1a) 1.0 µg DNA 322 € ABM lentivectors human
LV105860 CALR3 Lentiviral Vector (Human) (UbC) (pLenti-GIII-UbC) 1.0 µg DNA 322 € ABM lentivectors human
GENTAUR-58bdf126d9531 Anti- CALR3 Antibody 0.06 ml 265 € MBS Polyclonals human
GENTAUR-58bdf127440d3 Anti- CALR3 Antibody 0.12 ml 348 € MBS Polyclonals human
GENTAUR-58be45f912739 Anti- CALR3 Antibody 100ug 393 € MBS Polyclonals human
GENTAUR-58be53b179252 Anti- CALR3 Antibody 50ug 365 € MBS Polyclonals human
GENTAUR-58be53b1cc3b4 Anti- CALR3 Antibody 0.2 mg 663 € MBS Polyclonals human
abx148840 Anti-CALR3 Antibody 200 μg 369 € abbex human
abx910171 Anti-CALR3 siRNA inquire 50 € abbex human
abx910172 Anti-CALR3 siRNA inquire 50 € abbex human
GWB-MV324I CALR3 antibody 1 vial 521 € genways human
GWB-70B56E CALR3 Over-expression Lysate reagent 1 tube 463 € genways human
RP-0181H Recombinant Human CALR / Calreticulin Protein (Fc Tag) 20μg 572 € adv human
RP-0180H Recombinant Human CALR / Calreticulin Protein (His Tag) 20μg 572 € adv human
abx261273 Anti-Calreticulin 3 Protein (Recombinant) 5 µg 238 € abbex human
abx168364 Anti-Calreticulin Protein (Recombinant) 10 μg 412 € abbex human
abx262024 Anti-Calreticulin Protein (Recombinant) 1 mg 4675 € abbex human
GWB-P1496A Calreticulin, 18-417aa, Recombinant Protein bulk Ask price € genways bulk human
abx570209 Anti-Human Calreticulin (CRT) ELISA Kit 96 tests 760 € abbex human
abx150912 Anti-Human Calreticulin ELISA Kit 96 tests 891 € abbex human
abx250954 Anti-Human Calreticulin ELISA Kit inquire 50 € abbex human
YSGSPA601D Calreticulin, ~63kD, Clone: FMC75, Mouse Monoclonal antibody-Human, Hamster, Monkey; WB/IP/ICC/IHC/EIA/FACS 50 ug 655 € accurate-monoclonals monkey
YSGSPA601F Calreticulin, ~63kD, Clone: FMC75, Mouse Monoclonal antibody-Human, Hamster, Monkey; WB/IP/ICC/IHC/EIA/FACS 0.2mg 1380 € accurate-monoclonals monkey
AE52559HU-48 ELISA test for Human Calreticulin (CALR) 1x plate of 48 wells 402 € abebio human