Recombinant Human Putative Polycomb Group Protein ASXL1 (N-GST)

Contact us
Catalog number: CG54
Price: 2277 €
Supplier: MBS Recombinant Proteins
Product name: Recombinant Human Putative Polycomb Group Protein ASXL1 (N-GST)
Quantity: 1000ug
Other quantities: 1 mg 2486€ 10 µg 202€ 500 µg 1755€
Related search:

More details :

Reacts with: Human
Source: proteins, Recombinants or rec
Description: Recombinant Human Additional sex combs-like protein 1 is produced by our E, coli expression system and the target gene encoding Lys1477-Arg1541 is expressed with a GST tag at the N-terminus
Molecular Weight: 33, 6 kD
UniProt number: Q8IXJ9
State of the product: Freeze-dried
Shipping conditions: Ambient temperature
Formulation: 2 um filtered solution of 20 mM PB,150 mM sodium chloride, 4, Lyophilized from a 0, pH7
Storage recommendations: -20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at <
Reconstitution: Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml
Purity: and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid: MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPKSDLEVLFQGPLGSKANFGASHSASLSLQMFTDSSTVESISLQCACSLKAMIMCQGCGAFCHDDCIGPSKLCVLCLVVR
Levels of endotoxin: 11 IEU/ug, LAL test shows less than than 0
Properties: Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp
Group: recombinants
Gene target: Putative Polycomb Group Protein ASXL1 (N-GST)
Short name: Recombinant Putative Polycomb Group Protein ASXL1 (N-GST)
Technique: E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Species: Humans, Human
Alternative name: sapiens Putative Polycomb family Protein ASXL1 (N-GST), recombinant H
Alternative technique: rec
Identity: 18318
Gene: ASXL1 | More about : ASXL1
Long gene name: additional sex combs like 1, transcriptional regulator
Synonyms gene name: additional sex combs like 1 (Drosophila)
Synonyms: KIAA0978
Locus: 20q11, 21
Discovery year: 2002-03-06
GenBank acession: AJ438952
Entrez gene record: 171023
Pubmed identfication: 12657473
RefSeq identity: NM_015338
Havana BLAST/BLAT: OTTHUMG00000032218
Locus Specific Databases: LRG_630

Related Products :

AE55294HU-48 ELISA test for Human Putative Polycomb group protein ASXL1 (ASXL1) 1x plate of 48 wells 373 € abebio human
AE55294HU-96 Human Putative Polycomb group protein ASXL1 (ASXL1) ELISA Kit 1x plate of 96 wells 612 € abebio human
CG54 Recombinant Human Putative Polycomb Group Protein ASXL1 (N-GST) 500 µg 1755 € novo human
AE55291HU-48 ELISA test for Human Putative Polycomb group protein ASXL2 (ASXL2) 1x plate of 48 wells 373 € abebio human
AE55289HU-48 ELISA test for Human Putative Polycomb group protein ASXL3 (ASXL3) 1x plate of 48 wells 373 € abebio human
AE55291HU-96 Human Putative Polycomb group protein ASXL2 (ASXL2) ELISA Kit 1x plate of 96 wells 612 € abebio human
AE55289HU-96 Human Putative Polycomb group protein ASXL3 (ASXL3) ELISA Kit 1x plate of 96 wells 612 € abebio human
abx250650 Anti-Human Polycomb group RING finger protein 6 ELISA Kit inquire 50 € abbex human
AE28439HU-48 ELISA test for Human Polycomb group RING finger protein 1 (PCGF1) 1x plate of 48 wells 373 € abebio human
AE28435HU-48 ELISA test for Human Polycomb group RING finger protein 2 (PCGF2) 1x plate of 48 wells 373 € abebio human
AE28433HU-48 ELISA test for Human Polycomb group RING finger protein 3 (PCGF3) 1x plate of 48 wells 373 € abebio human
AE28431HU-48 ELISA test for Human Polycomb group RING finger protein 5 (PCGF5) 1x plate of 48 wells 373 € abebio human
AE28428HU-48 ELISA test for Human Polycomb group RING finger protein 6 (PCGF6) 1x plate of 48 wells 373 € abebio human
AE28439HU-96 Human Polycomb group RING finger protein 1 (PCGF1) ELISA Kit 1x plate of 96 wells 612 € abebio human
AE28435HU-96 Human Polycomb group RING finger protein 2 (PCGF2) ELISA Kit 1x plate of 96 wells 612 € abebio human
AE28433HU-96 Human Polycomb group RING finger protein 3 (PCGF3) ELISA Kit 1x plate of 96 wells 612 € abebio human
DL-PCGF4-Hu Human Polycomb Group Ring Finger Protein 4 PCGF4 ELISA Kit 96T 904 € DL elisas human
AE28431HU-96 Human Polycomb group RING finger protein 5 (PCGF5) ELISA Kit 1x plate of 96 wells 612 € abebio human
AE28428HU-96 Human Polycomb group RING finger protein 6 (PCGF6) ELISA Kit 1x plate of 96 wells 612 € abebio human
MBS624265 Mel18 (RNF110, MEL-18, Polycomb Group RING Finger Protein 2, DNA-binding Protein Mel-18, RING Finger Protein 110, Zinc Finger Protein 144, PCGF2, ZNF144) Antibody 100ug 591 € MBS Polyclonals_1 human
MBS621307 Mel18 (RNF110, DNA-binding protein Mel-18, RING finger protein 110, Zinc finger protein 144, polycomb group ring finger 2) Antibody 100ug 625 € MBS Polyclonals_1 human
GENTAUR-58bdc7915294f Anti- Polycomb Group Ring Finger Protein 4 (PCGF4) Antibody 100ug 531 € MBS Polyclonals human
GENTAUR-58bdce3c972bd Anti- Polycomb Group Ring Finger Protein 4 (PCGF4) Antibody 100ug 492 € MBS Polyclonals human
GENTAUR-58bdce3d0e22b Anti- Polycomb Group Ring Finger Protein 4 (PCGF4) Antibody 50ug 376 € MBS Polyclonals human
GENTAUR-58bdd611ee6e0 Anti- Polycomb Group Ring Finger Protein 4 (PCGF4) Antibody 100ug 564 € MBS Polyclonals human
MBS615672 Bmi-1, aa252-264 (RNF51, MGC12685, BUP, Polycomb Group RING Finger Protein 4) Antibody 100ug 829 € MBS Polyclonals_1 human
GENTAUR-58bd711811473 Bovine Polycomb group RING finger protein 1 (PCGF1) 100ug 1763 € MBS Recombinant Proteins bovine
GENTAUR-58bd711854ba7 Bovine Polycomb group RING finger protein 1 (PCGF1) 1000ug 1763 € MBS Recombinant Proteins bovine
GENTAUR-58bd7118a03db Bovine Polycomb group RING finger protein 1 (PCGF1) 100ug 2277 € MBS Recombinant Proteins bovine
GENTAUR-58bd7118eed6e Bovine Polycomb group RING finger protein 1 (PCGF1) 1000ug 2277 € MBS Recombinant Proteins bovine