Recombinant Human NEDD8-Conjugating Enzyme UBC12, UBE2M

Contact us
Catalog number: CG49
Price: 558 €
Supplier: MBS Polyclonals_1
Product name: Recombinant Human NEDD8-Conjugating Enzyme UBC12, UBE2M
Quantity: 100ug
Other quantities: 1 mg 1014€ 10 µg 80€ 50 µg 141€
Related search:

More details :

Reacts with: Human
Source: proteins, Recombinants or rec
Description: Activating enzymes will cut off the domain that is biological active to become functional, If the substrate is DNA they are called restriction enzymes, Enzymes are cleaving the substrate
Molecular Weight: 20, 9 kD
UniProt number: P61081
State of the product: Liquid
Shipping conditions: Dry ice/ice packs
Formulation: 10%glycerol , 150 mM sodium chloride, 2 mM DTT, 2 um filtered solution of 50 mM HEPES, 5, Supplied as a 0, pH 7
Storage recommendations: -20°, Please minimize freeze-thaw cycles, stable for 6 months after receipt, C, Store at <
Reconstitution: Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml
Purity: and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid: MIKLFSLKQQKKEEESAGGTKGSSKKASAAQLRIQKDINELNLPKTCDISFSDPDDLLNFKLVICPDEGFYKSGKFVFSFKVGQGYPHDPPKVKCETMVYHPNIDLEGNVCLNILREDWKPVLTINSIIYGLQYLFLEPNPEDPLNKEAAEVLQNNRRLFEQNVQRSMRGGYIGSTYFERCLK
Levels of endotoxin: 11 IEU/ug, LAL test shows less than than 0
Properties: Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp
Group: recombinants
Gene target: UBE2M, NEDD8-Conjugating UBC12
Short name: UBE2M, Recombinant NEDD8-Conjugating Enzyme UBC12
Technique: E, coli recombinant proteins are , enzymes, novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Species: Humans, Human
Alternative name: UBE2M, sapiens NEDD8-Conjugating Enzyme UBC12, recombinant H
Alternative technique: rec
Identity: 12491
Gene: UBE2M | More about : UBE2M
Long gene name: ubiquitin conjugating enzyme E2 M
Synonyms gene name: ubiquitin-conjugating enzyme E2M (homologous to yeast UBC12) ubiquitin-conjugating enzyme E2M (UBC12 homolog, yeast) ubiquitin-conjugating enzyme E2M
Synonyms: hUbc12 UBC12
Locus: 19q13, 43
Discovery year: 1999-01-22
GenBank acession: AB012191
Entrez gene record: 9040
Pubmed identfication: 9694792
RefSeq identity: NM_003969
Classification: Ubiquitin conjugating enzymes E2
Havana BLAST/BLAT: OTTHUMG00000183548

Related Products :

CG49 Recombinant Human NEDD8-Conjugating Enzyme UBC12, UBE2M 1 mg 1014 € novo human
GENTAUR-58bd75e76a915 Ashbya gossypii NEDD8-conjugating enzyme UBC12 (UBC12) 100ug 1586 € MBS Recombinant Proteins human
GENTAUR-58bd75e7b45ab Ashbya gossypii NEDD8-conjugating enzyme UBC12 (UBC12) 1000ug 1586 € MBS Recombinant Proteins human
GENTAUR-58bd75e8130c7 Ashbya gossypii NEDD8-conjugating enzyme UBC12 (UBC12) 100ug 2089 € MBS Recombinant Proteins human
GENTAUR-58bd75e85e82b Ashbya gossypii NEDD8-conjugating enzyme UBC12 (UBC12) 1000ug 2089 € MBS Recombinant Proteins human
GENTAUR-58bd7cb9b2dce Kluyveromyces lactis NEDD8-conjugating enzyme UBC12 (UBC12) 100ug 1586 € MBS Recombinant Proteins human
GENTAUR-58bd7cba3ffcf Kluyveromyces lactis NEDD8-conjugating enzyme UBC12 (UBC12) 1000ug 1586 € MBS Recombinant Proteins human
GENTAUR-58bd7cba9dec3 Kluyveromyces lactis NEDD8-conjugating enzyme UBC12 (UBC12) 100ug 2089 € MBS Recombinant Proteins human
GENTAUR-58bd7cbb12de1 Kluyveromyces lactis NEDD8-conjugating enzyme UBC12 (UBC12) 1000ug 2089 € MBS Recombinant Proteins human
GENTAUR-58bcfe3fda34c Saccharomyces cerevisiae NEDD8-conjugating enzyme UBC12 (UBC12) 100ug 1597 € MBS Recombinant Proteins human
GENTAUR-58bcfe4031ef5 Saccharomyces cerevisiae NEDD8-conjugating enzyme UBC12 (UBC12) 1000ug 1597 € MBS Recombinant Proteins human
GENTAUR-58bcfe407b125 Saccharomyces cerevisiae NEDD8-conjugating enzyme UBC12 (UBC12) 100ug 2100 € MBS Recombinant Proteins human
GENTAUR-58bcfe40b29d7 Saccharomyces cerevisiae NEDD8-conjugating enzyme UBC12 (UBC12) 1000ug 2100 € MBS Recombinant Proteins human
GENTAUR-58ba6019ccc9b Schizosaccharomyces pombe NEDD8-conjugating enzyme ubc12 (ubc12) 100ug 1564 € MBS Recombinant Proteins human
GENTAUR-58ba601aa9b2b Schizosaccharomyces pombe NEDD8-conjugating enzyme ubc12 (ubc12) 1000ug 1564 € MBS Recombinant Proteins human
GENTAUR-58ba601b45f52 Schizosaccharomyces pombe NEDD8-conjugating enzyme ubc12 (ubc12) 100ug 2067 € MBS Recombinant Proteins human
GENTAUR-58ba601bd3cd0 Schizosaccharomyces pombe NEDD8-conjugating enzyme ubc12 (ubc12) 1000ug 2067 € MBS Recombinant Proteins human
GENTAUR-58bd9e0923767 Yarrowia lipolytica NEDD8-conjugating enzyme UBC12 (UBC12) 100ug 1569 € MBS Recombinant Proteins human
GENTAUR-58bd9e099dcee Yarrowia lipolytica NEDD8-conjugating enzyme UBC12 (UBC12) 1000ug 1569 € MBS Recombinant Proteins human
GENTAUR-58bd9e0a05b65 Yarrowia lipolytica NEDD8-conjugating enzyme UBC12 (UBC12) 100ug 2072 € MBS Recombinant Proteins human
GENTAUR-58bd9e0a62828 Yarrowia lipolytica NEDD8-conjugating enzyme UBC12 (UBC12) 1000ug 2072 € MBS Recombinant Proteins human
GENTAUR-58bd9b974a68c Dictyostelium discoideum NEDD8-conjugating enzyme Ubc12 (ube2m) 100ug 1691 € MBS Recombinant Proteins human
GENTAUR-58bd9b97971d7 Dictyostelium discoideum NEDD8-conjugating enzyme Ubc12 (ube2m) 1000ug 1691 € MBS Recombinant Proteins human
GENTAUR-58bd9b97ed972 Dictyostelium discoideum NEDD8-conjugating enzyme Ubc12 (ube2m) 100ug 2205 € MBS Recombinant Proteins human
GENTAUR-58bd9b9847e3d Dictyostelium discoideum NEDD8-conjugating enzyme Ubc12 (ube2m) 1000ug 2205 € MBS Recombinant Proteins human
GENTAUR-58bd5e8bd2dd1 Xenopus laevis NEDD8-conjugating enzyme Ubc12 (ube2m) 100ug 1580 € MBS Recombinant Proteins xenopus
GENTAUR-58bd5e8c30d1f Xenopus laevis NEDD8-conjugating enzyme Ubc12 (ube2m) 1000ug 1580 € MBS Recombinant Proteins xenopus
GENTAUR-58bd5e8c67d64 Xenopus laevis NEDD8-conjugating enzyme Ubc12 (ube2m) 100ug 2083 € MBS Recombinant Proteins xenopus
GENTAUR-58bd5e8cb6378 Xenopus laevis NEDD8-conjugating enzyme Ubc12 (ube2m) 1000ug 2083 € MBS Recombinant Proteins xenopus
MBS620751 Ubiquitin Conjugating Enzyme E2N (Ubiquitin-conjugating Enzyme E2 N, Ubiquitin-conjugating Enzyme E2N (Homologous to Yeast UBC13), Ubiquitin-conjugating Enzyme E2N (UBC13 Homolog Yeast), Ube2N, Bendless-like Ubiquitin Conjugating Enzyme, BLU, MGC131857, M 100ug 558 € MBS Polyclonals_1 yeast