Recombinant Human Parvulin-14, PIN4 (N-6His)

Contact us
Catalog number: CG44
Price: 587 €
Supplier: acr
Product name: Recombinant Human Parvulin-14, PIN4 (N-6His)
Quantity: 0,1 mg
Other quantities: 10 µg 146€ 50 µg 339€ 500 µg 1613€
Related search:

More details :

Reacts with: Human
Source: proteins, Recombinants or rec
Description: Recombinant Human Parvulin-14 is produced by our E, coli expression system and the target gene encoding Met1-Lys156 is expressed with a 6His tag at the N-terminus
Molecular Weight: 18, 8 kD
UniProt number: Q9Y237-2
State of the product: Liquid
Shipping conditions: Dry Ice/ice packs
Formulation: 150 mM sodium chloride, 2 um filtered solution of 20 mM PB, 4, Supplied as a 0, pH7
Storage recommendations: -20°, Please minimize freeze-thaw cycles, stable for 6 months after receipt, C, Store at <
Reconstitution: Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml
Purity: and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid: MGSSHHHHHHSSGLVPRGSHMPMAGLLKGLVRQLEQFRVQQQASKMPPKGKSGSGKAGKGGAASGSDSADKKAQGPKGGGNAVKVRHILCEKHGKIMEAMEKLKSGMRFNEVAAQYSEDKARQGGDLGWMTRGSMVGPFQEAAFALPVSGMDKPVFTDPPVKTKFGYHIIMVEGRK
Levels of endotoxin: 11 IEU/ug, LAL test shows less than than 0
Properties: Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp
Group: recombinants
Gene target: PIN4 (N-6His), Parvulin-14
Short name: PIN4 (N-6His), Recombinant Parvulin-14
Technique: E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Species: Humans, Human
Alternative name: PIN4 (N-6His), sapiens Parvulin-14, recombinant H
Alternative technique: rec
Identity: 8992
Gene: PIN4 | More about : PIN4
Long gene name: NIMA-interacting 4 , peptidylprolyl cis/trans isomerase
Synonyms gene name: 4 , 4 (parvulin) peptidylprolyl cis/trans isomerase NIMA-interacting, protein (peptidyl-prolyl cis/trans isomerase) NIMA-interacting
Synonyms: PAR14 PAR17 EPVH
Synonyms name: parvulin
Locus: Xq13, 1
Discovery year: 1998-08-26
GenBank acession: AB009690
Entrez gene record: 5303
Pubmed identfication: 16522211 17875217
RefSeq identity: NM_006223
Classification: Parvulins
Havana BLAST/BLAT: OTTHUMG00000021811
Locus Specific Databases: Mental Retardation database

Related Products :

CG44 Recombinant Human Parvulin-14, PIN4 (N-6His) 50 µg 339 € novo human
GENTAUR-58bd6e6993322 Emericella nidulans Peptidyl-prolyl cis-trans isomerase pin4 (pin4) 100ug 1442 € MBS Recombinant Proteins human
GENTAUR-58bd6e69e3f48 Emericella nidulans Peptidyl-prolyl cis-trans isomerase pin4 (pin4) 1000ug 1442 € MBS Recombinant Proteins human
GENTAUR-58bd6e6a342dc Emericella nidulans Peptidyl-prolyl cis-trans isomerase pin4 (pin4) 100ug 1945 € MBS Recombinant Proteins human
GENTAUR-58bd6e6a7725e Emericella nidulans Peptidyl-prolyl cis-trans isomerase pin4 (pin4) 1000ug 1945 € MBS Recombinant Proteins human
GENTAUR-58bd9542971fe Neosartorya fumigata Peptidyl-prolyl cis-trans isomerase pin4 (pin4) 100ug 1442 € MBS Recombinant Proteins human
GENTAUR-58bd95430cdce Neosartorya fumigata Peptidyl-prolyl cis-trans isomerase pin4 (pin4) 1000ug 1442 € MBS Recombinant Proteins human
GENTAUR-58bd95437b8b6 Neosartorya fumigata Peptidyl-prolyl cis-trans isomerase pin4 (pin4) 100ug 1945 € MBS Recombinant Proteins human
GENTAUR-58bd9543ef999 Neosartorya fumigata Peptidyl-prolyl cis-trans isomerase pin4 (pin4) 1000ug 1945 € MBS Recombinant Proteins human
GWB-P1040M PIN4, 1-156aa, Recombinant Protein bulk Ask price € genways bulk human
GENTAUR-58b9ae655e1b9 Bordetella pertussis Probable parvulin-type peptidyl-prolyl cis-trans isomerase (BP3561) 100ug 1713 € MBS Recombinant Proteins human
GENTAUR-58b9ae65b45e3 Bordetella pertussis Probable parvulin-type peptidyl-prolyl cis-trans isomerase (BP3561) 1000ug 1713 € MBS Recombinant Proteins human
GENTAUR-58b9ae662fd2e Bordetella pertussis Probable parvulin-type peptidyl-prolyl cis-trans isomerase (BP3561) 100ug 2227 € MBS Recombinant Proteins human
GENTAUR-58b9ae66a312a Bordetella pertussis Probable parvulin-type peptidyl-prolyl cis-trans isomerase (BP3561) 1000ug 2227 € MBS Recombinant Proteins human
GENTAUR-58ba2b48ee38b Bordetella pertussis Probable parvulin-type peptidyl-prolyl cis-trans isomerase (BP3561) 100ug 1713 € MBS Recombinant Proteins human
GENTAUR-58ba2b4995d0c Bordetella pertussis Probable parvulin-type peptidyl-prolyl cis-trans isomerase (BP3561) 1000ug 1713 € MBS Recombinant Proteins human
GENTAUR-58ba2b49ec9b0 Bordetella pertussis Probable parvulin-type peptidyl-prolyl cis-trans isomerase (BP3561) 100ug 2227 € MBS Recombinant Proteins human
GENTAUR-58ba2b4a41e63 Bordetella pertussis Probable parvulin-type peptidyl-prolyl cis-trans isomerase (BP3561) 1000ug 2227 € MBS Recombinant Proteins human
GENTAUR-58bdad18ee3ba Rickettsia bellii Parvulin-like PPIase (plp) 100ug 1779 € MBS Recombinant Proteins human
GENTAUR-58bdad19674b3 Rickettsia bellii Parvulin-like PPIase (plp) 1000ug 1779 € MBS Recombinant Proteins human
GENTAUR-58bdad19b10ac Rickettsia bellii Parvulin-like PPIase (plp) 100ug 2293 € MBS Recombinant Proteins human
GENTAUR-58bdad1a0b45c Rickettsia bellii Parvulin-like PPIase (plp) 1000ug 2293 € MBS Recombinant Proteins human
GWB-BSP282 PIN4 Human Protein bulk Ask price € genways bulk human
LV262993 PIN4 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV) 1.0 µg DNA 322 € ABM lentivectors human
GENTAUR-58bdcb86d5979 Anti- Peptidyl Prolyl Cis/Trans Isomerase NIMA Interacting Protein 4 (PIN4) Antibody 50ug 365 € MBS Polyclonals human
GENTAUR-58bdcb872db62 Anti- Peptidyl Prolyl Cis/Trans Isomerase NIMA Interacting Protein 4 (PIN4) Antibody 100ug 470 € MBS Polyclonals human
GENTAUR-58bdd28801605 Anti- Peptidyl Prolyl Cis/Trans Isomerase NIMA Interacting Protein 4 (PIN4) Antibody 100ug 509 € MBS Polyclonals human
GENTAUR-58bdd4bc0dac6 Anti- Peptidyl Prolyl Cis/Trans Isomerase NIMA Interacting Protein 4 (PIN4) Antibody 100ug 542 € MBS Polyclonals human
AR09938PU-L anti-PIN4 (1-156, His-tag) Antibody 0,5 mg 1500 € acr human
AR09938PU-N anti-PIN4 (1-156, His-tag) Antibody 0,1 mg 587 € acr human