Recombinant Human Signal Transducer and Activator of Transcription 5B, STAT5B (C-6His)

Contact us
Catalog number: CG38
Price: 509 €
Supplier: MBS Polyclonals
Product name: Recombinant Human Signal Transducer and Activator of Transcription 5B, STAT5B (C-6His)
Quantity: 100ug
Other quantities: 10 µg 202€ 50 µg 496€
Related search:

More details :

Reacts with: Human
Source: proteins, Recombinants or rec
Description: Recombinant Human STAT5B is produced by our E, coli expression system and the target gene encoding Met1-Thr321 is expressed with a 6His tag at the C-terminus
Molecular Weight: 38, 4 kD
UniProt number: P51692
State of the product: Liquid
Shipping conditions: Dry ice/ice packs
Formulation: 1 mM DTT, 50% Glycerol, pH 7, 2 um filtered solution of phosphate buffered saline, 4, Supplied as a 0
Storage recommendations: -20°, Please minimize freeze-thaw cycles, stable for 6 months after receipt, C, Store at <
Reconstitution: Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml
Purity: and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid: MAVWIQAQQLQGEALHQMQALYGQHFPIEVRHYLSQWIESQAWDSVDLDNPQENIKATQLLEGLVQELQKKAEHQVGEDGFLLKIKLGHYATQLQNTYDRCPMELVRCIRHILYNEQRLVREANNGSSPAGSLADAMSQKHLQINQTFEELRLVTQDTENELKKLQQTQEYFIIQYQESLRIQAQFGPLAQLSPQERLSRETALQQKQVSLEAWLQREAQTLQQYRVELAEKHQKTLQLLRKQQTIILDDELIQWKRRQQLAGNGGPPEGSLDVLQSWCEKLAEIIWQNRQQIRRAEHLCQQLPIPGPVEEMLAEVNATITLEHHHHHH
Levels of endotoxin: 11 IEU/ug, LAL test shows less than than 0
Properties: Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp
Group: recombinants
Gene target: STAT5B (C-6His), Signal Transducer Activator of Transcription 5B
Short name: STAT5B (C-6His), Recombinant Signal Transducer Activator of Transcription 5B
Technique: E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Species: Humans, Human
Alternative name: sapiens Signal Transducer and Activator on Transcription 5B, signal transducer and activator on transcription 5B (C-6His), recombinant H
Alternative technique: rec
Alternative to gene target: DNA-templated and biological process this GO :0006357 and regulation of transcription from RNA polymerase II promoter and biological process this GO :0006366 and transcription from RNA polymerase II promoter and biological process this GO :0006549 and isoleucine metabolic process and biological process this GO :0006573 and valine metabolic process and biological process this GO :0006600 and creatine metabolic process and biological process this GO :0006631 and fatty acid metabolic process and biological process this GO :0006953 and acute-phase response and biological process this GO :0007165 and signal transduction and biological process this GO :0007259 and JAK-STAT cascade and biological process this GO :0007548 and sex differentiation and biological process this GO :0007565 and female pregnancy and biological process this GO :0007595 and lactation and biological process this GO :0008284 and positive regulation of cell proliferation and biological process this GO :0019218 and regulation of steroid metabolic process and biological process this GO :0019221 and cytokine-mediated signaling pathway and biological process this GO :0019530 and taurine metabolic process and biological process this GO :0019903 and protein phosphatase binding and molecular function this GO :0019915 and lipid storage and biological process this GO :0030155 and regulation of cell adhesion and biological process this GO :0030856 and regulation of epithelial cell differentiation and biological process this GO :0032355 and response to estradiol and biological process this GO :0032496 and response to lipopolysaccharide and biological process this GO :0032819 and positive regulation of natural killer cell proliferation and biological process this GO :0032825 and positive regulation of natural killer cell differentiation and biological process this GO :0032870 and cellular response to hormone stimulus and biological process this GO :0033077 and T cell differentiation in thymus and biological process this GO :0035259 and glucocorticoid receptor binding and molecular function this GO :0038161 and prolactin signaling pathway and biological process this GO :0040014 and regulation of multicellular organism growth and biological process this GO :0040018 and positive regulation of multicellular organism growth and biological process this GO :0042104 and positive regulation of activated T cell proliferation and biological process this GO :0042448 and progesterone metabolic process and biological process this GO :0043029 and T cell homeostasis and biological process this GO :0043066 and negative regulation of apoptotic process and biological process this GO :0043434 and response to peptide hormone and biological process this GO :0043565 and sequence-specific DNA binding and molecular function this GO :0045086 and positive regulation of interleukin-2 biosynthetic process and biological process this GO :0045087 and innate immune response and biological process this GO :0045471 and response to ethanol and biological process this GO :0045579 and positive regulation of B cell differentiation and biological process this GO :0045588 and positive regulation of gamma-delta T cell differentiation and biological process this GO :0045621 and positive regulation of lymphocyte differentiation and biological process this GO :0045647 and negative regulation of erythrocyte differentiation and biological process this GO :0045931 and positive regulation of mitotic cell cycle and biological process this GO :0045944 and positive regulation of transcription from RNA polymerase II promoter and biological process this GO :0045954 and positive regulation of natural killer cell mediated cytotoxicity and biological process this GO :0046449 and creatinine metabolic process and biological process this GO :0046543 and development of secondary female sexual characteristics and biological process this GO :0046544 and development of secondary male sexual characteristics and biological process this GO :0046983 and protein dimerization activity and molecular function this GO :0048541 and Peyer's patch development and biological process this GO :0048661 and positive regulation of smooth muscle cell proliferation and biological process this GO :0050729 and positive regulation of inflammatory response and biological process this GO :0051272 and positive regulation of cellular component movement and biological process this GO :0060397 and JAK-STAT cascade involved in growth hormone signaling pathway and biological process this GO :0070669 and response to interleukin-2 and biological process this GO :0070670 and response to interleukin-4 and biological process this GO :0070672 and response to interleukin-15 and biological process this GO :0071363 and cellular response to growth factor stimulus and biological process this GO :0071364 and cellular response to epidermal growth factor stimulus and biological process, STAT5, STAT5B and IDBG-50532 and ENSG00000173757 and 102723386, STAT5B and IDBG-640180 and ENSBTAG00000010125 and 282376, Stat5b and IDBG-211594 and ENSMUSG00000020919 and 20851, nuclei, protein dimerization activity, this GO :0000255 and allantoin metabolic process and biological process this GO :0000979 and RNA polymerase II core promoter sequence-specific DNA binding and molecular function this GO :0001553 and luteinization and biological process this GO :0001666 and response to hypoxia and biological process this GO :0001779 and natural killer cell differentiation and biological process this GO :0001889 and liver development and biological process this GO :0003677 and DNA binding and molecular function this GO :0003682 and chromatin binding and molecular function this GO :0003690 and double-stranded DNA binding and molecular function this GO :0003700 and sequence-specific DNA binding transcription factor activity and molecular function this GO :0004871 and signal transducer activity and molecular function this GO :0005509 and calcium ion binding and molecular function this GO :0005515 and protein binding and molecular function this GO :0005634 and nucleus and cellular component this GO :0005654 and nucleoplasm and cellular component this GO :0005737 and cytoplasm and cellular component this GO :0005829 and cytosol and cellular component this GO :0006101 and citrate metabolic process and biological process this GO :0006103 and 2-oxoglutarate metabolic process and biological process this GO :0006105 and succinate metabolic process and biological process this GO :0006107 and oxaloacetate metabolic process and biological process this GO :0006355 and regulation of transcription, this GO :0000979 : RNA polymerase II core promoter sequence-specific DNA binding, this GO :0000979 : RNA polymerase II core promoter sequence-specific DNA binding and also this GO :0003677 : DNA binding and also this GO :0003682 : chromatin binding and also this GO :0003690 : double-stranded DNA binding and also this GO :0003700 : sequence-specific DNA binding transcription factor activity and also this GO :0004871 : signal transducer activity and also this GO :0005509 : calcium ion binding and also this GO :0005515 : protein binding and also this GO :0019903 : protein phosphatase binding and also this GO :0035259 : glucocorticoid receptor binding and also this GO :0043565 : sequence-specific DNA binding and also this GO :0046983 : protein dimerization activity, this GO :0003677 : DNA binding, this GO :0003682 : chromatin binding, this GO :0003690 : double-stranded DNA binding, this GO :0003700 : sequence-specific DNA binding transcription factor activity, this GO :0004871 : signal transducer activity, this GO :0005509 : calcium ion binding, this GO :0005515 : protein binding, this GO :0019903 : protein phosphatase binding, this GO :0035259 : glucocorticoid receptor binding, this GO :0043565 : sequence-specific DNA binding, this GO :0046983 : protein dimerization activity, 6777, 789476, signal transducer and activator of transcription 5B
Identity: 11367
Gene: STAT5B | More about : STAT5B
Long gene name: signal transducer and activator of transcription 5B
Locus: 17q21, 2
Discovery year: 1997-01-28
GenBank acession: BC065227
Entrez gene record: 6777
Pubmed identfication: 8631883
RefSeq identity: NM_012448
Classification: SH2 domain containing
Havana BLAST/BLAT: OTTHUMG00000150724
Locus Specific Databases: STAT5Bbase: Mutation registry for Growth hormone insensitivity with immunodeficiency LOVD - Leiden Open Variation Database LRG_192

Related Products :

CG38 Recombinant Human Signal Transducer and Activator of Transcription 5B, STAT5B (C-6His) 50 µg 496 € novo human
DL-STAT5B-Hu Human Signal Transducer And Activator Of Transcription 5B STAT5B ELISA Kit 96T 869 € DL elisas human
GWB-DB76EF Signal Transducer and Activator Of Transcription 5B (STAT5B) Rabbit antibody to or anti-Human Polyclonal (N- terminus) antibody 1 vial 602 € genways human
EKU07343 Signal Transducer And Activator Of Transcription 5B (STAT5B) ELISA kit 1 plate of 96 wells 783 € Biomatik ELISA kits human
CF29 Recombinant Human Signal Transducer and Activator of Transcription 3, STAT3 (C-6His) 1 mg 2486 € novo human
CG37 Recombinant Human Signal Transducer and Activator of Transcription 6, STAT6 (C-6His) 10 µg 202 € novo human
CF22 Recombinant Human Signal Transducer and Activator of Transcription 1, STAT1 500 µg 1755 € novo human
MBS622700 TORC1 (Transducer of CREB Protein 1, Transducer of Regulated cAMP Response Element Binding Protein 1, Transducer of Regulated cAMP Response Element-Binding Protein (CREB) 1, TORC 1, TORC-1, CREB-regulated Transcription Coactivator 1, CRTC1, KIAA0616, Muco Antibody 100ul 785 € MBS Polyclonals_1 human
abx167717 Anti-Signal Transducer And Activator Of Transcription 2 Protein (Recombinant) 100 μg 905 € abbex human
abx168305 Anti-Signal Transducer And Activator Of Transcription 5B Protein (Recombinant) 100 μg 847 € abbex human
DL-STAT1-Hu Human Signal Transducer And Activator Of Transcription 1 STAT1 ELISA Kit 96T 869 € DL elisas human
DL-STAT2-Hu Human Signal Transducer And Activator Of Transcription 2 STAT2 ELISA Kit 96T 869 € DL elisas human
DL-STAT3-Hu Human Signal Transducer And Activator Of Transcription 3 STAT3 ELISA Kit 96T 869 € DL elisas human
DL-STAT4-Hu Human Signal Transducer And Activator Of Transcription 4 STAT4 ELISA Kit 96T 869 € DL elisas human
DL-STAT5A-Hu Human Signal Transducer And Activator Of Transcription 5A STAT5A ELISA Kit 96T 869 € DL elisas human
DL-STAT6-Hu Human Signal Transducer And Activator Of Transcription 6 STAT6 ELISA Kit 96T 869 € DL elisas human
GWB-91F174 Signal Transducer and Activator Of Transcription 1 (STAT1) Mouse antibody to or anti-Human Monoclonal (SAT-84) antibody 1 vial 602 € genways human
GWB-5A59FA Signal Transducer and Activator Of Transcription 1 (STAT1) Mouse antibody to or anti-Human Monoclonal (SM1) antibody 1 x 1 vial 602 € genways human
GWB-CCDF4E Signal Transducer and Activator Of Transcription 1 (STAT1) Rabbit antibody to or anti-Human Polyclonal (C- terminus) antibody 1 vial 602 € genways human
GWB-C89266 Signal Transducer and Activator Of Transcription 2 (STAT2) Rabbit antibody to or anti-Human Polyclonal (aa832-851) antibody 1 vial 648 € genways human
GWB-AE70C7 Signal Transducer and Activator Of Transcription 2 (STAT2) Rabbit antibody to or anti-Human Polyclonal (C- terminus) antibody 1 vial 602 € genways human
GWB-725616 Signal Transducer and Activator Of Transcription 4 (STAT4) Rabbit antibody to or anti-Human Polyclonal (N- terminus) antibody 1 tube 602 € genways human
GENTAUR-58bdcd8d3af56 Anti- Signal Transducer And Activator Of Transcription 1 (STAT1) Antibody 100ug 481 € MBS Polyclonals human
GENTAUR-58bdcd8d830a0 Anti- Signal Transducer And Activator Of Transcription 1 (STAT1) Antibody 50ug 370 € MBS Polyclonals human
GENTAUR-58bdd1612ff06 Anti- Signal Transducer And Activator Of Transcription 1 (STAT1) Antibody 100ug 520 € MBS Polyclonals human
GENTAUR-58bdd5fde29dd Anti- Signal Transducer And Activator Of Transcription 1 (STAT1) Antibody 100ug 542 € MBS Polyclonals human
GENTAUR-58bdd79f03186 Anti- Signal Transducer And Activator Of Transcription 1 (STAT1) Antibody 100ug 553 € MBS Polyclonals human
GENTAUR-58bdd9757865b Anti- Signal Transducer And Activator Of Transcription 1 (STAT1) Antibody 50ug 365 € MBS Polyclonals human
GENTAUR-58bdd975b0074 Anti- Signal Transducer And Activator Of Transcription 1 (STAT1) Antibody 100ug 470 € MBS Polyclonals human
GENTAUR-58bddc9464eec Anti- Signal Transducer And Activator Of Transcription 1 (STAT1) Antibody 100ug 509 € MBS Polyclonals human