| Reacts with: |
Human |
| Source: |
proteins, Recombinants or rec |
| Description: |
Recombinant Human STAT6 is produced by our E, coli expression system and the target gene encoding Ser627-Ser837 is expressed with a 6His tag at the C-terminus |
| Molecular Weight: |
23, 9 kD |
| UniProt number: |
P42226 |
| State of the product: |
Freeze-dried |
| Shipping conditions: |
Ambient temperature |
| Formulation: |
2 um filtered solution of 20 mM PB,150 mM sodium chloride, 4, Lyophilized from a 0, pH7 |
| Storage recommendations: |
-20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at < |
| Reconstitution: |
Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml |
| Purity: |
and determined by Polyacrylamide gel electrophoresis, Greater than 95% |
| Sequence of the amino acid: |
MSHYKPEQMGKDGRGYVPATIKMTVERDQPLPTPELQMPTMVPSYDLGMAPDSSMSMQLGPDMVPQVYPPHSHSIPPYQGLSPEESVNVLSAFQEPHLQMPPSLGQMSLPFDQPHPQGLLPCQPQEHAVSSPDPLLCSDVTMVEDSCLSQPVTAFPQGTWIGEDIFPPLLPPTEQDLTKLLLEGQGESGGGSLGAQPLLQPSHYGQSGISMSLEHHHHHH |
| Levels of endotoxin: |
11 IEU/ug, LAL test shows less than than 0 |
| Properties: |
Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp |
| Group: |
recombinants |
| Gene target: |
STAT6 (C-6His), Signal Transducer Activator of Transcription 6 |
| Short name: |
STAT6 (C-6His), Recombinant Signal Transducer Activator of Transcription 6 |
| Technique: |
E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli |
| Species: |
Humans, Human |
| Alternative name: |
interleukin-4 induced (C-6His), sapiens Signal Transducer and Activator on Transcription 6, signal transducer and activator on transcription 6, recombinant H |
| Alternative technique: |
rec |
| Alternative to gene target: |
D12S1644 and IL-4-STAT and STAT6B and STAT6C, DNA-templated and biological process this GO :0006355 and regulation of transcription, DNA-templated and biological process this GO :0006357 and regulation of transcription from RNA polymerase II promoter and biological process this GO :0007165 and signal transduction and biological process this GO :0019221 and cytokine-mediated signaling pathway and biological process this GO :0019903 and protein phosphatase binding and molecular function this GO :0032481 and positive regulation of type I interferon production and biological process this GO :0033598 and mammary gland epithelial cell proliferation and biological process this GO :0034097 and response to cytokine and biological process this GO :0035771 and interleukin-4-mediated signaling pathway and biological process this GO :0042127 and regulation of cell proliferation and biological process this GO :0042802 and identical protein binding and molecular function this GO :0043565 and sequence-specific DNA binding and molecular function this GO :0045087 and innate immune response and biological process this GO :0045121 and membrane raft and cellular component this GO :0045944 and positive regulation of transcription from RNA polymerase II promoter and biological process this GO :0048295 and positive regulation of isotype switching to IgE isotypes and biological process this GO :0060443 and mammary gland morphogenesis and biological process this GO :0070301 and cellular response to hydrogen peroxide and biological process this GO :1902170 and cellular response to reactive nitrogen species and biological process, STAT6 and IDBG-42122 and ENSG00000166888 and 6778, STAT6 and IDBG-635695 and ENSBTAG00000006335 and 353105, Stat6 and IDBG-195602 and ENSMUSG00000002147 and 20852, interleukin-4 induced, nuclei, sequence-specific DNA binding, this GO :0000122 and negative regulation of transcription from RNA polymerase II promoter and biological process this GO :0000790 and nuclear chromatin and cellular component this GO :0000979 and RNA polymerase II core promoter sequence-specific DNA binding and molecular function this GO :0002296 and T-helper 1 cell lineage commitment and biological process this GO :0002829 and negative regulation of type 2 immune response and biological process this GO :0003677 and DNA binding and molecular function this GO :0003700 and sequence-specific DNA binding transcription factor activity and molecular function this GO :0004871 and signal transducer activity and molecular function this GO :0005509 and calcium ion binding and molecular function this GO :0005515 and protein binding and molecular function this GO :0005634 and nucleus and cellular component this GO :0005654 and nucleoplasm and cellular component this GO :0005737 and cytoplasm and cellular component this GO :0005829 and cytosol and cellular component this GO :0006351 and transcription, this GO :0000979 : RNA polymerase II core promoter sequence-specific DNA binding, this GO :0000979 : RNA polymerase II core promoter sequence-specific DNA binding and also this GO :0003677 : DNA binding and also this GO :0003700 : sequence-specific DNA binding transcription factor activity and also this GO :0004871 : signal transducer activity and also this GO :0005509 : calcium ion binding and also this GO :0005515 : protein binding and also this GO :0019903 : protein phosphatase binding and also this GO :0042802 : identical protein binding and also this GO :0043565 : sequence-specific DNA binding, this GO :0003677 : DNA binding, this GO :0003700 : sequence-specific DNA binding transcription factor activity, this GO :0004871 : signal transducer activity, this GO :0005509 : calcium ion binding, this GO :0005515 : protein binding, this GO :0019903 : protein phosphatase binding, this GO :0042802 : identical protein binding, this GO :0043565 : sequence-specific DNA binding, signal transducer and activator of transcription 6 |
| Identity: |
11368 |
| Gene: |
STAT6 |
More about : STAT6 |
| Long gene name: |
signal transducer and activator of transcription 6 |
| Synonyms gene name: |
interleukin-4 induced , signal transducer and activator of transcription 6 |
| Synonyms: |
D12S1644 IL-4-STAT |
| Locus: |
12q13 |
| Discovery year: |
1995-11-09 |
| GenBank acession: |
BC005823 BQ028928 |
| Entrez gene record: |
6778 |
| Pubmed identfication: |
9605853 8085155 |
| RefSeq identity: |
NM_003153 |
| Classification: |
SH2 domain containing |
| Havana BLAST/BLAT: |
OTTHUMG00000171194 |