Recombinant Human Ubiquitin-Conjugating Enzyme E2 Variant 1, UBE2V1 (C-6His)

Contact us
Catalog number: CG36
Price: 151 €
Supplier: novo
Product name: Recombinant Human Ubiquitin-Conjugating Enzyme E2 Variant 1, UBE2V1 (C-6His)
Quantity: 50 µg
Other quantities: 1 mg 1115€ 10 µg 100€ 500 µg 405€
Related search:

More details :

Reacts with: Human
Source: proteins, Recombinants or rec
Description: Activating enzymes will cut off the domain that is biological active to become functional, If the substrate is DNA they are called restriction enzymes, Enzymes are cleaving the substrate
Molecular Weight: 17, 5 kD
UniProt number: Q13404
State of the product: Liquid
Shipping conditions: Dry Ice/ice packs
Formulation: 100 mM sodium chloride, pH 8, 2 um filtered solution of 50 mM HEPES, Supplied as a 0
Storage recommendations: -20°, Please minimize freeze-thaw cycles, stable for 6 months after receipt, C, Store at <
Reconstitution: Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml
Purity: and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid: AATTGSGVKVPRNFRLLEELEEGQKGVGDGTVSWGLEDDEDMTLTRWTGMIIGPPRTIYENRIYSLKIECGPKYPEAPPFVRFVTKINMNGVNSSNGVVDPRAISVLAKWQNSYSIKVVLQELRRLMMSKENMKLPQPPEGQCYSNLEHHHHHH
Levels of endotoxin: 11 IEU/ug, LAL test shows less than than 0
Properties: Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp
Group: recombinants
Gene target: UBE2V1 (C-6His), Ubiquitin-Conjugating E2 Variant 1
Short name: UBE2V1 (C-6His), Recombinant Ubiquitin-Conjugating Enzyme E2 Variant 1
Technique: E, coli recombinant proteins are , enzymes, novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Species: Humans, Human
Alternative name: UBE2V1 (C-6His), sapiens Ubiquitin-Conjugating Enzyme E2 Variant 1, recombinant H
Alternative technique: rec
Identity: 12494
Gene: UBE2V1 | More about : UBE2V1
Long gene name: ubiquitin conjugating enzyme E2 V1
Synonyms gene: UBE2V
Synonyms gene name: ubiquitin-conjugating enzyme E2 variant 1
Synonyms: UEV-1 CROC-1 UEV1A CROC1
Locus: 20q13, 13
Discovery year: 1998-03-20
GenBank acession: U39360
Entrez gene record: 7335
Pubmed identfication: 9418904 9305758
RefSeq identity: NM_021988
Classification: Ubiquitin conjugating enzymes E2
Havana BLAST/BLAT: OTTHUMG00000152626

Related Products :

MBS620751 Ubiquitin Conjugating Enzyme E2N (Ubiquitin-conjugating Enzyme E2 N, Ubiquitin-conjugating Enzyme E2N (Homologous to Yeast UBC13), Ubiquitin-conjugating Enzyme E2N (UBC13 Homolog Yeast), Ube2N, Bendless-like Ubiquitin Conjugating Enzyme, BLU, MGC131857, M 100ug 558 € MBS Polyclonals_1 yeast
CG36 Recombinant Human Ubiquitin-Conjugating Enzyme E2 Variant 1, UBE2V1 (C-6His) 500 µg 405 € novo human
MBS620173 UbcH7 (E2-F1, L-UBC, UbcH7, UbcM4, Ubiquitin Carrier Protein L3, Ubiquitin-conjugating Enzyme E2 L3, Ubiquitin-conjugating Enzyme E2-L3, Ube2L3, Ubiquitin-protein Ligase L3) 100ug 735 € MBS Polyclonals_1 human
GWB-B17B15 Ubiquitin-conjugating Enzyme E2 Variant 1 (UBE2V1/UEV1A) Rabbit antibody to or anti-Human Polyclonal (aa31-49) antibody 1 vial 602 € genways human
CG24 Recombinant Human Ubiquitin-Conjugating Enzyme E2 Variant 2, UBE2V2, DDVIT1 (N-6His) 500 µg 1613 € novo human
MBS614179 UBE2I (UBE2I, ubiquitin-conjugating enzyme E2I (UBC9 homolog, yeast), C358B7.1, P18, UBC9, SUMO-1-protein ligase, ubiquitin carrier protein, ubiquitin conjugating enzyme 9, ubiquitin-conjugating enzyme E2I (homologous to yeast UBC9), ubiquitin-conjugating Antibody 100ug 591 € MBS Polyclonals_1 human
MBS617434 Ubiquitin Conjugating Enzyme E2L3 (UBE2L3, ubiquitin-conjugating enzyme E2L 3, UBCH7) Antibody 100ug 591 € MBS Polyclonals_1 human
MBS619190 Ubc9 (Ubiquitin Carrier Protein 9, Ubiquitin Conjugating Enzyme 9, UBC 9, UBC9 Homolog, UBC-9, UBCE9, C358B7.1, Homologous to Yeast UBC9, p18, SUMO Conjugating Enzyme UBC9, SUMO Protein Ligase, SUMO-1 Conjugating Enzyme, SUMO-1-protein Ligase, SUMO1 Conju 100ug 735 € MBS Polyclonals_1 yeast
MBS611592 UBE2V1 (TMEM189-UBE2V1 readthrough transcript, CROC1B, KUA-UEV) Antibody 100ug 509 € MBS Polyclonals_1 human
MBS612110 RAD6 (Rad-6, BHR6A, hHR6A, HR6A, mHR6A, RAD6A, RAD6B, UBC-1, UBC2, UBC6, UBCD6, UBE2B, Ubiquitin Carrier Protein, Ubiquitin-conjugating Enzyme E2 A, UBE2A, Ubiquitin-conjugating Enzyme E2-17kD, Ubiquitin-conjugating enzyme E2-21.5kD, Ubiquitin-protein Lig Antibody 100ul 785 € MBS Polyclonals_1 human
MBS623756 UBE2G2, NT (Ubiquitin-conjugating Enzyme E2 G2, Ubiquitin-protein Ligase G2, Ubiquitin Carrier Protein G2) 200ul 603 € MBS Polyclonals_1 human
MBS624307 UBE2Q2 (Ubiquitin-conjugating Enzyme E2 Q2, Ubiquitin Carrier Protein Q2, Ubiquitin-protein Ligase Q2) Antibody 100ug 658 € MBS Polyclonals_1 human
GENTAUR-58bd902d9ac8d Arabidopsis thaliana Ubiquitin-conjugating enzyme E2 variant 1A (UEV1A) 100ug 1520 € MBS Recombinant Proteins human
GENTAUR-58bd902e0a92c Arabidopsis thaliana Ubiquitin-conjugating enzyme E2 variant 1A (UEV1A) 1000ug 1520 € MBS Recombinant Proteins human
GENTAUR-58bd902e4aece Arabidopsis thaliana Ubiquitin-conjugating enzyme E2 variant 1A (UEV1A) 100ug 2022 € MBS Recombinant Proteins human
GENTAUR-58bd902ea5638 Arabidopsis thaliana Ubiquitin-conjugating enzyme E2 variant 1A (UEV1A) 1000ug 2022 € MBS Recombinant Proteins human
GENTAUR-58bdb3a2c7161 Bovine Ubiquitin-conjugating enzyme E2 variant 2 (UBE2V2) 100ug 1481 € MBS Recombinant Proteins bovine
GENTAUR-58bdb3a35a059 Bovine Ubiquitin-conjugating enzyme E2 variant 2 (UBE2V2) 1000ug 1481 € MBS Recombinant Proteins bovine
GENTAUR-58bdb3a3dfede Bovine Ubiquitin-conjugating enzyme E2 variant 2 (UBE2V2) 100ug 1984 € MBS Recombinant Proteins bovine
GENTAUR-58bdb3a456bc0 Bovine Ubiquitin-conjugating enzyme E2 variant 2 (UBE2V2) 1000ug 1984 € MBS Recombinant Proteins bovine
GENTAUR-58b87ff8dfe7c Saccharomyces cerevisiae Ubiquitin-conjugating enzyme variant MMS2 (MMS2) 100ug 1464 € MBS Recombinant Proteins human
GENTAUR-58b87ff948b09 Saccharomyces cerevisiae Ubiquitin-conjugating enzyme variant MMS2 (MMS2) 1000ug 1464 € MBS Recombinant Proteins human
GENTAUR-58b87ff9ddcfe Saccharomyces cerevisiae Ubiquitin-conjugating enzyme variant MMS2 (MMS2) 100ug 1967 € MBS Recombinant Proteins human
GENTAUR-58b87ffb9f48a Saccharomyces cerevisiae Ubiquitin-conjugating enzyme variant MMS2 (MMS2) 1000ug 1967 € MBS Recombinant Proteins human
MBS622932 UEV2 (Ubiquitin Conjugating Enzyme E2 Variant 2, UBE2V2, 1 alpha,25-dihydroxyvitamin D3-inducible, DDVIT1, EDAF1, EDPF1, Enterocyte Differentiation Promoting Factor, Methyl Methanesulfonate Sensitive 2, MMS2) Antibody 100ug 735 € MBS Polyclonals_1 human
C183 Recombinant Human Ubiquitin-Conjugating Enzyme E2 A, UBE2A (N-GST, 6His) 10 µg 80 € novo human
C862 Recombinant Human Ubiquitin-Conjugating Enzyme E2 B, UBE2B, HR6B (C-6His) 50 µg 369 € novo human
CG01 Recombinant Human Ubiquitin-Conjugating Enzyme E2 C, UBE2C, UBCH10 (N-6His) 50 µg 339 € novo human
CG45 Recombinant Human Ubiquitin-Conjugating Enzyme E2 K, UBE2K (N-6His, SUMO tag) 10 µg 80 € novo human
CG23 Recombinant Human Ubiquitin-Conjugating Enzyme E2 R2, UBE2R2, UBC3B (N-6His) 50 µg 151 € novo human