Recombinant Human Tachykinin-3, TAC3 (N-6His)

Contact us
Catalog number: CG30
Price: 602 €
Supplier: genways
Product name: Recombinant Human Tachykinin-3, TAC3 (N-6His)
Quantity: 1 vial
Other quantities: 1 mg 2283€ 50 µg 303€ 500 µg 1613€
Related search:

More details :

Reacts with: Human
Source: proteins, Recombinants or rec
Description: Recombinant Human Tachykinin-3 is produced by our E, coli expression system and the target gene encoding Gln17-Glu121 is expressed with a 6His tag at the N-terminus
Molecular Weight: 13, 9 kD
UniProt number: Q9UHF0
State of the product: Freeze-dried
Shipping conditions: Ambient temperature
Formulation: 2 um filtered solution of 20 mM TrisHCl,pH8, Lyophilized from a 0
Storage recommendations: -20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at <
Reconstitution: Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml
Purity: and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid: MGSSHHHHHHSSGLVPRGSHMQSFGAVCKEPQEEVVPGGGRSKRDPDLYQLLQRLFKSHSSLEGLLKALSQASTDPKESTSPEKRDMHDFFVGLMGKRSVQPDSPTDVNQENVPSFGILKYPPRAE
Levels of endotoxin: 11 IEU/ug, LAL test shows less than than 0
Properties: Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp
Group: recombinants
Gene target: TAC3 (N-6His), Tachykinin-3
Short name: TAC3 (N-6His), Recombinant Tachykinin-3
Technique: E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Species: Humans, Human
Alternative name: TAC3 (N-6His), sapiens Tachykinin-3, recombinant H
Alternative technique: rec
Identity: 11521
Gene: TAC3 | More about : TAC3
Long gene name: tachykinin 3
Synonyms gene: NKNB
Synonyms gene name: neuromedin K neurokinin beta
Synonyms: ZNEUROK1 NKB
Synonyms name: preprotachykinin-B
Locus: 12q13, 3
Discovery year: 1986-01-01
GenBank acession: AF186112
Entrez gene record: 6866
Pubmed identfication: 3479225 10866201
RefSeq identity: NM_001006667
Classification: Endogenous ligands
Havana BLAST/BLAT: OTTHUMG00000156958

Related Products :

CG30 Recombinant Human Tachykinin-3, TAC3 (N-6His) 500 µg 1613 € novo human
MBS248745 Anti-Human TAC3 / Tachykinin 200ul 597 € MBS Polyclonals_1 human
LV327690 TAC3 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV) 1.0 µg DNA 322 € ABM lentivectors human
AR09243PU-L anti-Neurokinin B / TAC3 (17-121, His-tag) Antibody 0,5 mg 1138 € acr human
AR09243PU-N anti-Neurokinin B / TAC3 (17-121, His-tag) Antibody 0,1 mg 485 € acr human
AP01090PU-N anti-Neurokinin B / TAC3 Antibody 50 Вµl 761 € acr human
RA25008-100 anti-Neurokinin B / TAC3 Antibody 0,1 ml 500 € acr human
abx905431 Anti-TAC3 siRNA inquire 50 € abbex human
abx935926 Anti-TAC3 siRNA 15 nmol 528 € abbex human
abx935927 Anti-TAC3 siRNA 15 nmol 528 € abbex human
GWB-MP132F TAC3 antibody 1 vial 521 € genways human
GWB-DFBEFF TAC3 Over-expression Lysate reagent 1 vial 463 € genways human
MBS129677 TAC3 Polyclonal Antibody 200ug 558 € MBS Polyclonals_1 human
GWB-DA5D97 Recombinant Human Tachykinin-3 bulk Ask price € genways bulk human
abx261005 Anti-Tachykinin-1 Protein (Recombinant) 1 mg 3559 € abbex human
abx261449 Anti-Tachykinin-3 Protein (Recombinant) 1 mg 3559 € abbex human
abx167773 Anti-Tachykinin Receptor 2 Protein (Recombinant) 100 μg 920 € abbex human
abx250646 Anti-Human Tachykinin-3 ELISA Kit 96 tests 659 € abbex human
abx156776 Anti-Human Tachykinin, Precursor 1 ELISA Kit 96 tests 934 € abbex human
abx153216 Anti-Human Tachykinin Receptor 1 ELISA Kit inquire 50 € abbex human
abx253237 Anti-Human Tachykinin Receptor 1 ELISA Kit inquire 50 € abbex human
abx571968 Anti-Human Tachykinin Receptor 1 (TACR1) ELISA Kit 96 tests 731 € abbex human
abx253238 Anti-Human Tachykinin Receptor 2 ELISA Kit inquire 50 € abbex human
abx572023 Anti-Human Tachykinin Receptor 2 (TACR2) ELISA Kit inquire 50 € abbex human
GWB-C83E99 antibody to or anti- Tachykinin Receptor 2 (TACR2) Human antibody 1 vial 1053 € genways human
GWB-D5770F antibody to or anti- Tachykinin Receptor 2 (TACR2) Human antibody 1 vial 1053 € genways human
DL-TACR1-Hu Human Tachykinin Receptor 1 TACR1 ELISA Kit 96T 846 € DL elisas human
DL-TACR2-Hu Human Tachykinin Receptor 2 TACR2 ELISA Kit 96T 846 € DL elisas human
SP-54736-1 Tachykinin (111-129) Beta-Prepro (Human) (AA: Ala-Leu-Asn-Ser-Val-Ala-Tyr-Glu-Arg-Ser-Ala-Met-Gln-Asn-Tyr-Glu-Arg-Arg-Arg) (MW: 2314.59) 1 mg 188 € adi human
GWB-DA2EFE Tachykinin Receptor 2 (TACR2) Rabbit antibody to or anti-Human Polyclonal antibody 1 vial 602 € genways human