Recombinant Human Ubiquitin-Conjugating Enzyme E2 C, UBE2C, UBCH10 (N-6His)

Contact us
Catalog number: CG01
Price: 603 €
Supplier: MBS Polyclonals_1
Product name: Recombinant Human Ubiquitin-Conjugating Enzyme E2 C, UBE2C, UBCH10 (N-6His)
Quantity: 200ul
Other quantities: 1 mg 2283€ 50 µg 339€ 500 µg 1613€
Related search:

More details :

Reacts with: Human
Source: proteins, Recombinants or rec
Description: Activating enzymes will cut off the domain that is biological active to become functional, If the substrate is DNA they are called restriction enzymes, Enzymes are cleaving the substrate
Molecular Weight: 23, 3 kD
UniProt number: O00762
State of the product: Liquid
Shipping conditions: Dry Ice/ice packs
Formulation: pH 7, 150 mM sodium chloride, 2 um filtered solution of 20 mM PB, Supplied as a 0
Storage recommendations: -20°, Please minimize freeze-thaw cycles, stable for 6 months after receipt, C, Store at <
Reconstitution: Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml
Purity: and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid: MRGSHHHHHHGSMASQNRDPAATSVAAARKGAEPSGGAARGPVGKRLQQELMTLMMSGDKGISAFPESDNLFKWVGTIHGAAGTVYEDLRYKLSLEFPSGYPYNAPTVKFLTPCYHPNVDTQGNICLDILKEKWSALYDVRTILLSIQSLLGEPNIDSPLNTHAAELWKNPTAFKKYLQETYSKQVTSQEP
Levels of endotoxin: 11 IEU/ug, LAL test shows less than than 0
Properties: Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp
Group: recombinants
Gene target: UBCH10 (N-6His), UBE2C, Ubiquitin-Conjugating E2 C
Short name: UBCH10 (N-6His), UBE2C, Recombinant Ubiquitin-Conjugating Enzyme E2 C
Technique: E, coli recombinant proteins are , enzymes, novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Species: Humans, Human
Alternative name: UBCH10 (N-6His), UBE2C, sapiens Ubiquitin-Conjugating Enzyme E2 C, recombinant H
Alternative technique: rec
Identity: 15937
Gene: UBE2C | More about : UBE2C
Long gene name: ubiquitin conjugating enzyme E2 C
Synonyms gene name: ubiquitin-conjugating enzyme E2C
Synonyms: UBCH10
Locus: 20q13, 12
Discovery year: 2001-07-31
GenBank acession: U73379
Entrez gene record: 11065
Pubmed identfication: 9122200
RefSeq identity: NM_007019
Classification: Ubiquitin conjugating enzymes E2
Havana BLAST/BLAT: OTTHUMG00000033038

Related Products :

MBS620751 Ubiquitin Conjugating Enzyme E2N (Ubiquitin-conjugating Enzyme E2 N, Ubiquitin-conjugating Enzyme E2N (Homologous to Yeast UBC13), Ubiquitin-conjugating Enzyme E2N (UBC13 Homolog Yeast), Ube2N, Bendless-like Ubiquitin Conjugating Enzyme, BLU, MGC131857, M 100ug 558 € MBS Polyclonals_1 yeast
CG01 Recombinant Human Ubiquitin-Conjugating Enzyme E2 C, UBE2C, UBCH10 (N-6His) 50 µg 339 € novo human
MBS620173 UbcH7 (E2-F1, L-UBC, UbcH7, UbcM4, Ubiquitin Carrier Protein L3, Ubiquitin-conjugating Enzyme E2 L3, Ubiquitin-conjugating Enzyme E2-L3, Ube2L3, Ubiquitin-protein Ligase L3) 100ug 735 € MBS Polyclonals_1 human
MBS614179 UBE2I (UBE2I, ubiquitin-conjugating enzyme E2I (UBC9 homolog, yeast), C358B7.1, P18, UBC9, SUMO-1-protein ligase, ubiquitin carrier protein, ubiquitin conjugating enzyme 9, ubiquitin-conjugating enzyme E2I (homologous to yeast UBC9), ubiquitin-conjugating Antibody 100ug 591 € MBS Polyclonals_1 human
MBS617434 Ubiquitin Conjugating Enzyme E2L3 (UBE2L3, ubiquitin-conjugating enzyme E2L 3, UBCH7) Antibody 100ug 591 € MBS Polyclonals_1 human
AR50505PU-N anti-UBE2C / UBCH10 (1-179, His-tag) Antibody 0,5 mg 1109 € acr human
AR50505PU-S anti-UBE2C / UBCH10 (1-179, His-tag) Antibody 0,1 mg 485 € acr human
AP16056PU-N anti-UBE2C / UBCH10 (C-term) Antibody 0,1 mg 558 € acr human
AP16056PU-T anti-UBE2C / UBCH10 (C-term) Antibody 20 Вµg 340 € acr human
AP17818PU-N anti-UBE2C / UBCH10 (N-term) Antibody 0,4 ml 587 € acr human
MBS421462 Goat anti-UBE2C / UBCH10 Antibody 100ug 370 € MBS Polyclonals_1 human
MBS422781 Goat anti-UBE2C / UBCH10 Antibody 100ug 370 € MBS Polyclonals_1 human
GENTAUR-58bd4fd24ad21 Human Ubiquitin-conjugating enzyme E2 C (UBE2C) 100ug 1569 € MBS Recombinant Proteins human
GENTAUR-58bd4fd2972ad Human Ubiquitin-conjugating enzyme E2 C (UBE2C) 1000ug 1569 € MBS Recombinant Proteins human
GENTAUR-58bd4fd2e116e Human Ubiquitin-conjugating enzyme E2 C (UBE2C) 100ug 2072 € MBS Recombinant Proteins human
GENTAUR-58bd4fd3375e4 Human Ubiquitin-conjugating enzyme E2 C (UBE2C) 1000ug 2072 € MBS Recombinant Proteins human
DL-UBE2C-Hu Human Ubiquitin Conjugating Enzyme E2C UBE2C ELISA Kit 96T 904 € DL elisas human
GENTAUR-58bd8fe53c1fa Bovine Ubiquitin-conjugating enzyme E2 C (UBE2C) 100ug 1569 € MBS Recombinant Proteins bovine
GENTAUR-58bd8fe595ece Bovine Ubiquitin-conjugating enzyme E2 C (UBE2C) 1000ug 1569 € MBS Recombinant Proteins bovine
GENTAUR-58bd8fe5efd74 Bovine Ubiquitin-conjugating enzyme E2 C (UBE2C) 100ug 2072 € MBS Recombinant Proteins bovine
GENTAUR-58bd8fe668270 Bovine Ubiquitin-conjugating enzyme E2 C (UBE2C) 1000ug 2072 € MBS Recombinant Proteins bovine
E-EL-Ch0533 Chicken UBE2C (Ubiquitin Conjugating Enzyme E2C) ELISA Kit 96T 568 € elabsciences chicken
EKU08018 Ubiquitin Conjugating Enzyme E2C (UBE2C) ELISA kit 1 plate of 96 wells 822 € Biomatik ELISA kits human
GENTAUR-58ba97f0c5270 Xenopus laevis Ubiquitin-conjugating enzyme E2 C (ube2c) 100ug 1569 € MBS Recombinant Proteins xenopus
GENTAUR-58ba97f12a421 Xenopus laevis Ubiquitin-conjugating enzyme E2 C (ube2c) 1000ug 1569 € MBS Recombinant Proteins xenopus
GENTAUR-58ba97f1d11fa Xenopus laevis Ubiquitin-conjugating enzyme E2 C (ube2c) 100ug 2072 € MBS Recombinant Proteins xenopus
GENTAUR-58ba97f23b292 Xenopus laevis Ubiquitin-conjugating enzyme E2 C (ube2c) 1000ug 2072 € MBS Recombinant Proteins xenopus
MBS619190 Ubc9 (Ubiquitin Carrier Protein 9, Ubiquitin Conjugating Enzyme 9, UBC 9, UBC9 Homolog, UBC-9, UBCE9, C358B7.1, Homologous to Yeast UBC9, p18, SUMO Conjugating Enzyme UBC9, SUMO Protein Ligase, SUMO-1 Conjugating Enzyme, SUMO-1-protein Ligase, SUMO1 Conju 100ug 735 € MBS Polyclonals_1 yeast
MBS612110 RAD6 (Rad-6, BHR6A, hHR6A, HR6A, mHR6A, RAD6A, RAD6B, UBC-1, UBC2, UBC6, UBCD6, UBE2B, Ubiquitin Carrier Protein, Ubiquitin-conjugating Enzyme E2 A, UBE2A, Ubiquitin-conjugating Enzyme E2-17kD, Ubiquitin-conjugating enzyme E2-21.5kD, Ubiquitin-protein Lig Antibody 100ul 785 € MBS Polyclonals_1 human
MBS623756 UBE2G2, NT (Ubiquitin-conjugating Enzyme E2 G2, Ubiquitin-protein Ligase G2, Ubiquitin Carrier Protein G2) 200ul 603 € MBS Polyclonals_1 human