| Reacts with: |
Rat |
| Source: |
proteins, Recombinants or rec |
| Description: |
IL-1&alpha, is a &alpha, - or alpha protein sometimes glycoprotein present in blood, The Recombinant Interleukin-1 Alpha |
| Molecular Weight: |
17, 9 kD |
| UniProt number: |
P16598 |
| State of the product: |
Freeze-dried |
| Shipping conditions: |
Ambient temperature |
| Formulation: |
pH7, 2 um filtered solution of phosphate buffered saline, 4, Lyophilized from a 0 |
| Storage recommendations: |
-20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at < |
| Reconstitution: |
Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml |
| Purity: |
and determined by Polyacrylamide gel electrophoresis, Greater than 95% |
| Sequence of the amino acid: |
MSAPHSFQNNLRYKLIRIVKQEFIMNDSLNQNIYVDMDRIHLKAASLNDLQLEVKFDMYAYSSGGDDSKYPVTLKVSNTQLFVSAQGEDKPVLLKEIPETPKLITGSETDLIFFWEKINSKNYFTSAAFPELLIATKEQSQVHLARGLPSMIDFQIS |
| Levels of endotoxin: |
11 IEU/ug, LAL test shows less than than 0 |
| About: |
Rats , There are less rat- than mouse clones however, Rats are used to make rat monoclonal anti mouse antibodies, Rattus norvegicus are often studied in vivo as a model of human genes in Sprague-Dawley or Wistar rats, genes from rodents , of the genus |
| Latin name: |
Rattus norvegicus |
| Group: |
recombinants |
| Gene target: |
IL-1&alpha, Interleukin-1 Alpha |
| Short name: |
IL-1&alpha, Recombinant Interleukin-1 Alpha |
| Technique: |
E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli |
| Host: |
Rat |
| Species: |
Rats |
| Alternative name: |
Interleukin-1&alpha, recombinant Rat Interleukin-1 a |
| Alternative technique: |
rec |