Recombinant Human Zinc Finger Protein 762, ZFN762, ZIK1 (N-T7 tag)

Contact us
Catalog number: CF74
Price: 509 €
Supplier: MBS Polyclonals_1
Product name: Recombinant Human Zinc Finger Protein 762, ZFN762, ZIK1 (N-T7 tag)
Quantity: 100ug
Other quantities: 1 mg 2486€ 10 µg 202€
Related search:

More details :

Reacts with: Human
Source: proteins, Recombinants or rec
Description: Recombinant Human Zinc Finger Protein 762 is produced by our E, coli expression system and the target gene encoding Met1-Cys384 is expressed with a T7 tag at the N-terminus
Molecular Weight: 44, 6 kD
UniProt number: Q3SY52
State of the product: Freeze-dried
Shipping conditions: Ambient temperature
Formulation: pH 7, 2 um filtered solution of 20 mM Tris, 5, Lyophilized from a 0
Storage recommendations: -20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at <
Reconstitution: Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml
Purity: and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid: MASMTGGQQMGRGSMAAAALRAPTQVTVSPETHMDLTKGCVTFEDIAIYFSQDEWGLLDEAQRLLYLEVMLENFALVASLGCGHGTEDEETPSDQNVSVGVSQSKAGSSTQKTQSCEMCVPVLKDILHLADLPGQKPYLVGECTNHHQHQKHHSAKKSLKRDMDRASYVKCCLFCMSLKPFRKWEVGKDLPAMLRLLRSLVFPGGKKPGTITECGEDIRSQKSHYKSGECGKASRHKHTPVYHPRVYTGKKLYECSKCGKAFRGKYSLVQHQRVHTGERPWECNECGKFFSQTSHLNDHRRIHTGERPYECSECGKLFRQNSSLVDHQKIHTGARPYECSQCGKSFSQKATLVKHQRVHTGERPYKCGECGNSFSQSAILNQHRRIHTGAKPYECGQC
Levels of endotoxin: 11 IEU/ug, LAL test shows less than than 0
Properties: Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp
Group: recombinants
Gene target: ZFN762, ZIK1 (N-T7 tag), Zinc Finger Protein 762
Short name: ZFN762, ZIK1 (N-T7 tag), Recombinant Zinc Finger Protein 762
Technique: E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Label: tag
Species: Humans, Human
Alternative name: ZFN762, ZIK1 (N-T7 detection labelled), sapiens Zinc Finger Protein 762, recombinant H
Alternative technique: rec
Identity: 33104
Gene: ZIK1 | More about : ZIK1
Long gene name: zinc finger protein interacting with K protein 1
Synonyms gene name: zinc finger protein interacting with K protein 1 homolog (mouse)
Synonyms: ZNF762
Locus: 19q13, 43
Discovery year: 2006-08-11
GenBank acession: AK092538
Entrez gene record: 284307
RefSeq identity: NM_001010879
Classification: Zinc fingers C2H2-type
Havana BLAST/BLAT: OTTHUMG00000183468

Related Products :

CF74 Recombinant Human Zinc Finger Protein 762, ZFN762, ZIK1 (N-T7 tag) 10 µg 202 € novo human
MBS619807 Zinc finger protein 350 (ZBRK1, ZNF350, KRAB zinc finger protein ZFQR, ZFQR, Zinc finger and BRCA1-interacting protein with a KRAB domain 1, Zinc-finger protein ZBRK1) Antibody 100ug 536 € MBS Polyclonals_1 human
MBS615590 Roquin (KIAA2025, Ring Finger and CCCH-type Zinc Finger Domain 1, RING Finger and C3H Zinc Finger Protein 1, RC3H1, RING Finger Protein 198, RNF198, RP5-1198E17.5, Sanroque Protein) Antibody 100ul 785 € MBS Polyclonals_1 human
MBS621899 ZNF230 (Zinc Finger Protein 230, C3HC4 Like Zinc Finger Protein, C3HC4-like Zinc Finger Protein, MGC8715, Ring Finger Protein 141, RNF141, ZFP26) 100ug 735 € MBS Polyclonals_1 human
MBS624594 ZBTB16, phosphorylated (Tyr334) (Zinc Finger And BTB Domain-containing Protein 16, Zinc Finger Protein PLZF, Promyelocytic Leukemia Zinc Finger Protein, Zinc Finger Protein 145, ZBTB16, PLZF, ZNF145) Antibody 200ul 603 € MBS Polyclonals_1 human
MBS619801 Zinc Finger and Homeobox 1 (Zinc Finger and Homeodomain Protein 1, Zinc Fingers and Homeobox 1, Zinc Fingers and Homeoboxes 1, Zinc Fingers and Homeoboxes Protein 1, ZHX 1, ZHX1, ZHX-1) Antibody 100ul 785 € MBS Polyclonals_1 human
MBS620448 ZNF261 (Zinc Finger Protein 261, ZFP261, DXS6673E, HGNC:13054, KIAA0385, MYM, XFIM, Zinc Finger MYM Type 3, Zinc Finger MYM-type Protein 3, ZMYM3, ZMYM3 Protein, ZNF198L2) Antibody 100ul 785 € MBS Polyclonals_1 human
MBS619945 ZNF265 (Zinc Finger Protein 265, ZRANB2, DKFZp686J1831, DKFZp686N09117, FLJ41119, Zinc Finger RAN Binding Domain Containing 2, Zinc Finger Ran-binding Domain-containing Protein 2, ZIS1, ZIS2) Antibody 100ug 785 € MBS Polyclonals_1 human
AE10492HU-48 ELISA test for Human Zinc finger protein interacting with ribonucleoprotein K (ZIK1) 1x plate of 48 wells 373 € abebio human
GENTAUR-58bdb8119b61d Human Zinc finger protein interacting with ribonucleoprotein K (ZIK1) 100ug 2348 € MBS Recombinant Proteins human
GENTAUR-58bdb8120151e Human Zinc finger protein interacting with ribonucleoprotein K (ZIK1) 1000ug 2348 € MBS Recombinant Proteins human
GENTAUR-58bdb8126cca3 Human Zinc finger protein interacting with ribonucleoprotein K (ZIK1) 100ug 2862 € MBS Recombinant Proteins human
GENTAUR-58bdb812cfacc Human Zinc finger protein interacting with ribonucleoprotein K (ZIK1) 1000ug 2862 € MBS Recombinant Proteins human
AE10492HU Human Zinc finger protein interacting with ribonucleoprotein K (ZIK1) ELISA Kit 48 wells plate 480 € ab-elisa elisas human
AE10492HU-96 Human Zinc finger protein interacting with ribonucleoprotein K (ZIK1) ELISA Kit 1x plate of 96 wells 612 € abebio human
MBS612969 MURF1 (Muscle-specific RING Finger Protein 1, MURF-1, FLJ32380, Iris Ring Finger Protein, IRF, Ring Finger Protein 28, RNF28, Striated Muscle RING Zinc Finger Protein, SMRZ, Tripartite Motif Containing 63, Tripartite Motif Containing Protein 63, TRIM63, U 100ug 735 € MBS Polyclonals_1 human
MBS612590 Rabenosyn 5 (FYVE-finger-containing Rab5 Effector Protein Rabenosyn-5, Zinc Finger FYVE Domain Containing 20, Zinc Finger FYVE Domain-containing Protein 20, ZFYVE20) 100ug 735 € MBS Polyclonals_1 human
RP-762 Recombinant (E.Coli) Human CD99 2 μg 405 € adi human
MBS624265 Mel18 (RNF110, MEL-18, Polycomb Group RING Finger Protein 2, DNA-binding Protein Mel-18, RING Finger Protein 110, Zinc Finger Protein 144, PCGF2, ZNF144) Antibody 100ug 591 € MBS Polyclonals_1 human
MBS621307 Mel18 (RNF110, DNA-binding protein Mel-18, RING finger protein 110, Zinc finger protein 144, polycomb group ring finger 2) Antibody 100ug 625 € MBS Polyclonals_1 human
GWB-B5BFE8 Muscle specificity Ring Finger protein 1; Striated Muscle RING Zinc Finger protein; Muscle specificity Ring Finger protein 2; Iris Rin 1 vial 602 € genways human
GWB-D6DB18 Muscle specificity Ring Finger protein 1; Striated Muscle RING Zinc Finger protein; Muscle specificity Ring Finger protein 2; Iris Rin 1 vial 602 € genways human
MBS612715 MIZF (MBD2 Interacting Zinc Finger Protein, Methyl CpG Binding Protein 2 Interacting Zinc Finger Protein, MBD2 (Methyl-CpG-Binding Protein)-Interacting Zinc Finger Protein) Antibody 200ul 558 € MBS Polyclonals_1 human
MBS615234 CNBP (ZNF9, Zinc finger protein 9, HGNC:13164, CNBP1, DM2, PROMM, RNF163, Proximal myotonic myopathy nucleic acid binding protein, zinc finger protein 273) 100ug 735 € MBS Polyclonals_1 human
MBS624264 Zinc finger protein 180 (ZNF180, ZNF180 protein, Zinc finger protein 180 (HHZ168), isoform CRA_c) 200ul 625 € MBS Polyclonals_1 human
MBS618964 ZNF10 (Zinc Finger Protein 10, Zinc Finger Protein KOX1) 50ug 382 € MBS Polyclonals_1 human
MBS618964 ZNF10 (Zinc Finger Protein 10, Zinc Finger Protein KOX1) Antibody 100ug 564 € MBS Polyclonals_1 human
MBS610734 ZNF330 (Zinc Finger Protein 330, HSA6591, Nucleolar Cysteine-rich Protein, Zinc Finger Autoantigen 330) Antibody 50ug 625 € MBS Polyclonals_1 human
GWB-ASC470 Human PDGFR alpha (Ab-762) Antibody bulk Ask price € genways bulk human
MBS620970 OAZ (ZNF423, zinc finger protein 423, Ebfaz, KIAA0760, MGC138520, MGC138522, OAZ, Roaz, ZFP423, Zfp104, OLF-1/EBF associated zinc finger, Smad- and Olf-interacting zinc finger protein, early B-cell factor associated zinc finger protein) Antibody 100ug 509 € MBS Polyclonals_1 human