Recombinant Human Sulfotransferase 4A1, SULT4A1

Contact us
Catalog number: CF71
Price: 1603 €
Supplier: MBS Recombinant Proteins
Product name: Recombinant Human Sulfotransferase 4A1, SULT4A1
Quantity: 1000ug
Other quantities: 1 mg 2486€ 10 µg 202€ 500 µg 1755€
Related search:

More details :

Reacts with: Human
Source: proteins, Recombinants or rec
Description: Recombinant Human Sulfotransferase 4A1 is produced by our E, coli expression system and the target gene encoding Met1-Leu284 is expressed
Molecular Weight: 33 kD
UniProt number: Q9BR01
State of the product: Liquid
Shipping conditions: Dry Ice/ice packs
Formulation: 150 mM sodium chloride, 2 um filtered solution of 20 mM PB, 4, Supplied as a 0, pH7
Storage recommendations: -20°, Please minimize freeze-thaw cycles, stable for 6 months after receipt, C, Store at <
Reconstitution: Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml
Purity: and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid: MAESEAETPSTPGEFESKYFEFHGVRLPPFCRGKMEEIANFPVRPSDVWIVTYPKSGTSLLQEVVYLVSQGADPDEIGLMNIDEQLPVLEYPQPGLDIIKELTSPRLIKSHLPYRFLPSDLHNGDSKVIYMARNPKDLVVSYYQFHRSLRTMSYRGTFQEFCRRFMNDKLGYGSWFEHVQEFWEHRMDSNVLFLKYEDMHRDLVTMVEQLARFLGVSCDKAQLEALTEHCHQLVDQCCSAEALPVGRGRVGLWKDIFTVSMNEKFDLVYKQKMGKCDLTFDFYL
Levels of endotoxin: 11 IEU/ug, LAL test shows less than than 0
Properties: Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp
Group: recombinants
Gene target: SULT4A1, Sulfotransferase 4A1
Short name: SULT4A1, Recombinant Sulfotransferase 4A1
Technique: E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Species: Humans, Human
Alternative name: SULT4A1, sapiens Sulfotransferase 4A1, recombinant H
Alternative technique: rec
Identity: 14903
Gene: SULT4A1 | More about : SULT4A1
Long gene name: sulfotransferase family 4A member 1
Synonyms gene name: member 1 , sulfotransferase family 4A
Synonyms: SULTX3 hBR-STL-1
Locus: 22q13, 31
Discovery year: 2001-03-14
GenBank acession: AF188698
Entrez gene record: 25830
Pubmed identfication: 10698717
RefSeq identity: NM_014351
Classification: Sulfotransferases, cytosolic
Havana BLAST/BLAT: OTTHUMG00000141314

Related Products :

CF71 Recombinant Human Sulfotransferase 4A1, SULT4A1 10 µg 202 € novo human
MBS622667 SULT4A1 (sulfotransferase family 4A, Member 1, Brain sulfotransferase-like protein, Nervous system sulfotransferase, brain sulphotransferase-like, nervous system cytosolic sulfotransferase, sulfotransferase-related protein) Antibody 100ug 774 € MBS Polyclonals_1 human
MBS624314 SULT2B1 (Sulfotransferase Family, Cytosolic, 2B, Member 1, Alcohol Sulfotransferase, HSST2, Hydroxysteroid Sulfotransferase 2, ST2B1, Sulfotransferase 2B1) Antibody 100ug 774 € MBS Polyclonals_1 human
MBS620110 Carbohydrate Sulfotransferase 1 (CHST1, Carbohydrate (keratan sulfate Gal-6) sulfotransferase 1, C6ST, Carbohydrate Galactose/N-acetylglucosamine/N-acetylglucosamine 6-O-sulfotransferase 1, GST-1, Keratan sulfate Gal-6 sulfotransferase, KS6ST, KSGal6ST, K 100ug 774 € MBS Polyclonals_1 human
MBS620338 Carbohydrate Sulfotransferase 2 (CHST2, Carbohydrate (N-acetylglucosamine-6-O) sulfotransferase 2, C6ST, Carbohydrate Galactose/N-acetylglucosamine/N-acetylglucosamine 6-O-sulfotransferase 2, GlcNAc6ST-1, Gn6ST, GN6ST, GST2, GST-2, N-acetylglucosamine 6-O 100ug 774 € MBS Polyclonals_1 human
MBS621259 Carbohydrate Sulfotransferase 4 (CHST4, Carbohydrate (CHST4, Carbohydrate (N-acetylglucosamine 6-O) sulfotransferase 4, Galactose/N-acetylglucosamine/N-acetylglucosamine 6-O-sulfotransferase 3, GlcNAc6ST-2, GST-3, HEC-GlcNAc6ST, HEC-GLCNAC-6-ST, L-selecti Antibody 100ug 774 € MBS Polyclonals_1 human
MBS621397 Carbohydrate Sulfotransferase 5 (CHST5, Carbohydrate (N-acetylglucosamine 6-O) sulfotransferase 5, ALYE870, FLJ22167, GlcNAc6ST-3, GST4-alpha, hIGn6ST, I-GlcNAc6ST, Intestinal GlcNAc-6-sulfotransferase, MGC74625, PRO1886) 100ug 509 € MBS Polyclonals_1 human
MBS621707 Carbohydrate Sulfotransferase (CHST4, Carbohydrate (N-acetylglucosamine 6-O) sulfotransferase 4, Galactose/N-acetylglucosamine/N-acetylglucosamine 6-O-sulfotransferase 3, GlcNAc6ST-2, GST-3, HEC-GlcNAc6ST, HEC-GLCNAC-6-ST, L-selectin ligand sulfotransfera Antibody 100ug 553 € MBS Polyclonals_1 human
MBS624612 SULT1C1, ID (Sulfotransferase 1C2, ST1C2, Sulfotransferase 1C1, SULT1C#1, humSULTC2, SULT1C2) Antibody 200ul 603 € MBS Polyclonals_1 human
GENTAUR-58bde7b7a678e Mouse Monoclonal [clone 4A1] (IgG2a,k) to Human UBE2D2 / UBCH5B Antibody 50ug 663 € MBS mono human
AP12302PU-N anti-SULT4A1 (N-term) Antibody 0,4 ml 587 € acr human
GENTAUR-58be5bac398a2 Anti-SULT4A1 (Polyclonal), ALEXA Fluor 594 100 microliters 489 € Bioss Polyclonal Antibodies human
abx905373 Anti-SULT4A1 siRNA inquire 50 € abbex human
abx935656 Anti-SULT4A1 siRNA 30 nmol 717 € abbex human
abx935657 Anti-SULT4A1 siRNA 30 nmol 717 € abbex human
bsm-50170M GAPDH-SO3 (4A1) Monoclonal Antibody 0.1ml 362 € Bioss Primary Unconjugated Antibodies human
ACLF015 Infectious Salmon Anaemia virus (ISAV); Clone: 4A1, Mouse Monoclonal antibody- 500ul 379 € accurate-monoclonals mouse
YSRTMCA4688G Influenza A non structural protein, Mouse Monoclonal antibody-; Clone: 4A1 1 mg Ask price € accurate-monoclonals mouse
YSRTMCA4688 Influenza A Non-Structural Protein, Mouse Monoclonal antibody-; Clone: 4A1, ELISA 200ug 404 € accurate-monoclonals mouse
LIMA/sima4A1 Large/Small Intestineal Mucinous Ag. (LIMA & SIMA), predominantly LIMA, Clone: LIMA/sima 4A1, Mouse Monoclonal antibody-Hu;frozen/paraffin, IH 1000ul Ask price € accurate-monoclonals mouse
GENTAUR-58b812ea60095 Mouse Prolactin-4A1 (Prl4a1) 100ug 1603 € MBS Recombinant Proteins mouse
GENTAUR-58b812eab7ed0 Mouse Prolactin-4A1 (Prl4a1) 1000ug 1603 € MBS Recombinant Proteins mouse
GENTAUR-58b812eb2bab7 Mouse Prolactin-4A1 (Prl4a1) 100ug 2116 € MBS Recombinant Proteins mouse
GENTAUR-58b812eb79c8d Mouse Prolactin-4A1 (Prl4a1) 1000ug 2116 € MBS Recombinant Proteins mouse
GENTAUR-58b83c4aa9aa3 Mouse Prolactin-4A1 (Prl4a1) 100ug 1603 € MBS Recombinant Proteins mouse
GENTAUR-58b83c4b0f30e Mouse Prolactin-4A1 (Prl4a1) 1000ug 1603 € MBS Recombinant Proteins mouse
GENTAUR-58b83c4b63596 Mouse Prolactin-4A1 (Prl4a1) 100ug 2116 € MBS Recombinant Proteins mouse
GENTAUR-58b83c4bcb3f4 Mouse Prolactin-4A1 (Prl4a1) 1000ug 2116 € MBS Recombinant Proteins mouse
GENTAUR-58bc47803ca18 Rat Prolactin-4A1 (Prl4a1) 100ug 1603 € MBS Recombinant Proteins rat
GENTAUR-58bc4780a1188 Rat Prolactin-4A1 (Prl4a1) 1000ug 1603 € MBS Recombinant Proteins rat