Recombinant Human γ-Synuclein, SNCG

Contact us
Catalog number: CF67
Price: 322 €
Supplier: ABM lentivectors
Product name: Recombinant Human γ-Synuclein, SNCG
Quantity: 1.0 µg DNA
Other quantities: 1 mg 1014€ 10 µg 80€ 50 µg 141€
Related search:

More details :

Reacts with: Human
Source: proteins, Recombinants or rec
Description: Recombinant Human Gamma-Synuclein is produced by our E, coli expression system and the target gene encoding Met1-Asp127 is expressed
Molecular Weight: 13, 6 kD
UniProt number: O76070
State of the product: Freeze-dried
Shipping conditions: Ambient temperature
Formulation: 150 mM sodium chloride, 2 um filtered solution of 20 mM PB, 4, Lyophilized from a 0, pH7
Storage recommendations: -20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at <
Reconstitution: Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml
Purity: and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid: GSHMDVFKKGFSIAKEGVVGAVEKTKQGVTEAAEKTKEGVMYVGAKTKENVVQSVTSVAEKTKEQANAVSEAVVSSVNTVATKTVEEAENIAVTSGVVRKEDLRPSAPQQEGEASKEKEEVAEEAQSGGD
Levels of endotoxin: 11 IEU/ug, LAL test shows less than than 0
Properties: Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp
Group: recombinants
Gene target: SNCG, &gamma, -Synuclein
Short name: SNCG, -Synuclein, Recombinant &gamma
Technique: E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Species: Humans
Alternative name: SNCG, sapiens &gamma, -Synuclein, recombinant H
Alternative technique: rec
Identity: 11141
Gene: SNCG | More about : SNCG
Long gene name: synuclein gamma
Synonyms: BCSG1 SR persyn
Synonyms name: synoretin breast cancer-specific gene 1
Locus: 10q23, 2
Discovery year: 1998-04-07
GenBank acession: AF044311
Entrez gene record: 6623
Pubmed identfication: 9044857 9700196
Havana BLAST/BLAT: OTTHUMG00000018656
Locus Specific Databases: ALSOD, the Amyotrophic Lateral Sclerosis Online Genetic Database

Related Products :

MBS620047 Synuclein, gamma (Synuclein gamma, Gamma Synuclein, SNCG, SNCG Protein, Breast Cancer Specific Gene 1, Breast Cancer Specific Gene 1 Protein, BCSG1, Breast Cancer Specific Protein 1, Persyn, PRSN, Synoretin, SR) 0.02 miligrams 586 € MBS Polyclonals_1 human
MBS619694 Synuclein, pan (Alpha Synuclein, Beta Synuclein, Breast Cancer Specific Gene 1 Protein, Breast Cancer-specific Gene 1 Protein, BCSG1, Gamma Synuclein, Gamma-synuclein, Non-A beta Component of AD Amyloid, Non-A4 Component of Amyloid Precursor, NACP, PARK1, Antibody 100ul 652 € MBS Polyclonals_1 human
CF67 Recombinant Human γ-Synuclein, SNCG 50 µg 141 € novo human
MBS242356 Anti-Human SNCG / Gamma-Synuclein Antibody 0.05 ml 597 € MBS Polyclonals_1 human
abx572111 Anti-Human Synuclein Gamma (SNCg) ELISA Kit 96 tests 731 € abbex human
DL-SNCg-Hu Human Synuclein Gamma SNCg ELISA Kit 96T 846 € DL elisas human
MBS243108 PAb (IgG) to Human SNCG / Gamma-Synuclein Antibody 0.05 ml 597 € MBS Polyclonals_1 human
MBS247852 PAb (IgG) to Human SNCG / Gamma-Synuclein Antibody 50ug 597 € MBS Polyclonals_1 human
SA6012 anti-Gamma-Synuclein / SNCG (1-127) Antibody 0,1 mg 384 € acr human
SA6012X anti-Gamma-Synuclein / SNCG (1-127) Antibody 0,5 mg 833 € acr human
AM06134PU-N anti-Gamma-Synuclein / SNCG Antibody 0,1 ml 572 € acr human
AP06417PU-N anti-Gamma-Synuclein / SNCG Antibody 0,1 mg 558 € acr human
AP22638PU-N anti-Gamma-Synuclein / SNCG Antibody 50 Вµl 732 € acr human
C0334-1 anti-Gamma-Synuclein / SNCG Antibody 50 Вµg 347 € acr human
C0334-2 anti-Gamma-Synuclein / SNCG Antibody 0,1 mg 500 € acr human
CPA2090-100ul anti-Gamma-Synuclein / SNCG Antibody 0,1 ml 442 € acr human
CPA2090-200ul anti-Gamma-Synuclein / SNCG Antibody 0,2 ml 688 € acr human
CPA2090-30ul anti-Gamma-Synuclein / SNCG Antibody 30 Вµl 326 € acr human
SP6000 anti-Gamma-Synuclein / SNCG Antibody 0,1 ml 500 € acr human
SP6000S anti-Gamma-Synuclein / SNCG Antibody 50 Вµl 384 € acr human
GENTAUR-58bdc5264cab8 Anti- Synuclein Gamma (SNCg) Antibody 50ug 359 € MBS Polyclonals human
GENTAUR-58bdc526a9581 Anti- Synuclein Gamma (SNCg) Antibody 100ug 459 € MBS Polyclonals human
GENTAUR-58bdc5a3c295e Anti- Synuclein Gamma (SNCg) Antibody 100ug 542 € MBS Polyclonals human
GENTAUR-58bdd5d537a9c Anti- Synuclein Gamma (SNCg) Antibody 100ug 531 € MBS Polyclonals human
EKU07563 Synuclein Gamma (SNCg) ELISA kit 1 plate of 96 wells 745 € Biomatik ELISA kits human
MBS620042 Tubulin, gamma (TUBG, Tubulin gamma 1 Chain, TUBG1, Tubulin gamma 2 Chain, TUBG2, Gamma 1 Tubulin, Gamma 2 Tubulin, Gamma Tubulin 1, Gamma Tubulin 2, Gamma Tubulin Complex Component 1, GCP 1, GCP-1, MGC131994, Xgam) (Cy3) Antibody 100ul 696 € MBS Polyclonals_1 human
MBS620533 Synuclein, alpha, beta, gamma (SNCA, Alpha Synuclein, MGC110988, Non-A beta Component of AD Amyloid, Non-A4 Component of Amyloid Precursor, NACP, PARK1, PARK4, Parkinson Disease Familial 1, PD1) Antibody 1000ug 647 € MBS Polyclonals_1 human
MEDCLA891 Synuclein, alpha, non-AB comp. of Amyloid Precursor Prot. (NCAP), NO X w/beta-Synuclein, Clone: KM51, Mouse Monoclonal X-Hu; paraffin, IH/No WB 1000ul 1141 € accurate-monoclonals mouse
MBS611055 Heterochromatin Protein 1 gamma, (CBX3, chromobox homolog 3 (HP1 gamma homolog, Drosophila), HGNC:1553, HECH, HP1-GAMMA, HP1Hs-gamma, HP1 gamma homolog, chromobox homolog 3, chromobox homolog 3 (Drosophila HP1 gamma), heterochromatin protein HP1 gamma, he Antibody 100ug 591 € MBS Polyclonals_1 drosophila
LV315097 SNCG Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV) 1.0 µg DNA 322 € ABM lentivectors human