| Reacts with: |
Human |
| Source: |
proteins, Recombinants or rec |
| Description: |
Recombinant Human CRADD/ is produced by our E, coli expression system and the target gene encoding Met1-Glu199 is expressed |
| Molecular Weight: |
23 kD |
| UniProt number: |
P78560 |
| State of the product: |
Freeze-dried |
| Shipping conditions: |
Ambient temperature |
| Formulation: |
150 mM sodium chloride, 2 um filtered solution of 20 mM PB, 4, Lyophilized from a 0, pH7 |
| Storage recommendations: |
-20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at < |
| Reconstitution: |
Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml |
| Purity: |
and determined by Polyacrylamide gel electrophoresis, Greater than 95% |
| Sequence of the amino acid: |
GSHMEARDKQVLRSLRLELGAEVLVEGLVLQYLYQEGILTENHIQEINAQTTGLRKTMLLLDILPSRGPKAFDTFLDSLQEFPWVREKLKKAREEAMTDLPAGDRLTGIPSHILNSSPSDRQINQLAQRLGPEWEPMVLSLGLSQTDIYRCKANHPHNVQSQVVEAFIRWRQRFGKQATFQSLHNGLRAVEVDPSLLLHMLE |
| Levels of endotoxin: |
11 IEU/ug, LAL test shows less than than 0 |
| Properties: |
Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine, , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp |
| Group: |
recombinants |
| Gene target: |
CRADD, Death Domain Protein CRADD |
| Short name: |
CRADD, Recombinant Death Domain- Protein CRADD |
| Technique: |
E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli |
| Species: |
Humans, Human |
| Alternative name: |
CASP2 and RIPK1 domain containing adaptor including death domain, sapiens Death Domain-Containing Protein CASP2 and RIPK1 domain containing adaptor including death domain, recombinant H |
| Alternative technique: |
rec |
| Alternative to gene target: |
CRADD and IDBG-51368 and ENSG00000169372 and 8738, CRADD and IDBG-630849 and ENSBTAG00000005107 and 615788, Cradd and IDBG-187068 and ENSMUSG00000045867 and 12905, MRT34 and RAIDD, bridging, bridging and also this GO :0070513 : death domain binding, bridging and molecular function this GO :0042981 and regulation of apoptotic process and biological process this GO :0070513 and death domain binding and molecular function this GO :0071260 and cellular response to mechanical stimulus and biological process this GO :2001235 and positive regulation of apoptotic signaling pathway and biological process, nuclei, protein binding, signal transduction by p53 class mediator resulting in cell cycle arrest and biological process this GO :0007165 and signal transduction and biological process this GO :0008625 and extrinsic apoptotic signaling pathway via death domain receptors and biological process this GO :0030674 and protein binding, this GO :0002020 and protease binding and molecular function this GO :0005515 and protein binding and molecular function this GO :0005622 and intracellular and cellular component this GO :0005634 and nucleus and cellular component this GO :0005737 and cytoplasm and cellular component this GO :0006919 and activation of cysteine-type endopeptidase activity involved in apoptotic process and biological process this GO :0006977 and DNA damage response, this GO :0002020 : protease binding, this GO :0002020 : protease binding and also this GO :0005515 : protein binding and also this GO :0030674 : protein binding, this GO :0005515 : protein binding, this GO :0030674 : protein binding, this GO :0070513 : death domain binding, CASP2 and RIPK1 domain containing adaptor with death domain |
| Identity: |
2340 |
| Gene: |
CRADD |
More about : CRADD |
| Long gene name: |
CASP2 and RIPK1 domain containing adaptor with death domain |
| Synonyms: |
RAIDD |
| Synonyms name: |
RIP-associated ICH1/CED3-homologous protein with death domain |
| Locus: |
12q22 |
| Discovery year: |
1999-05-07 |
| GenBank acession: |
U84388 |
| Entrez gene record: |
8738 |
| Pubmed identfication: |
8985253 9044836 |
| RefSeq identity: |
NM_003805 |
| Classification: |
Caspase recruitment domain containing |
| Havana BLAST/BLAT: |
OTTHUMG00000170322 |