Recombinant Human Death Domain-Containing Protein CRADD, CRADD

Contact us
Catalog number: CF64
Price: Ask price €
Supplier: genways bulk
Product name: Recombinant Human Death Domain-Containing Protein CRADD, CRADD
Quantity: bulk
Other quantities: 10 µg 202€ 50 µg 496€ 500 µg 1755€
Related search:

More details :

Reacts with: Human
Source: proteins, Recombinants or rec
Description: Recombinant Human CRADD/ is produced by our E, coli expression system and the target gene encoding Met1-Glu199 is expressed
Molecular Weight: 23 kD
UniProt number: P78560
State of the product: Freeze-dried
Shipping conditions: Ambient temperature
Formulation: 150 mM sodium chloride, 2 um filtered solution of 20 mM PB, 4, Lyophilized from a 0, pH7
Storage recommendations: -20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at <
Reconstitution: Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml
Purity: and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid: GSHMEARDKQVLRSLRLELGAEVLVEGLVLQYLYQEGILTENHIQEINAQTTGLRKTMLLLDILPSRGPKAFDTFLDSLQEFPWVREKLKKAREEAMTDLPAGDRLTGIPSHILNSSPSDRQINQLAQRLGPEWEPMVLSLGLSQTDIYRCKANHPHNVQSQVVEAFIRWRQRFGKQATFQSLHNGLRAVEVDPSLLLHMLE
Levels of endotoxin: 11 IEU/ug, LAL test shows less than than 0
Properties: Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp
Group: recombinants
Gene target: CRADD, Death Domain Protein CRADD
Short name: CRADD, Recombinant Death Domain- Protein CRADD
Technique: E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Species: Humans, Human
Alternative name: CASP2 and RIPK1 domain containing adaptor including death domain, sapiens Death Domain-Containing Protein CASP2 and RIPK1 domain containing adaptor including death domain, recombinant H
Alternative technique: rec
Alternative to gene target: CRADD and IDBG-51368 and ENSG00000169372 and 8738, CRADD and IDBG-630849 and ENSBTAG00000005107 and 615788, Cradd and IDBG-187068 and ENSMUSG00000045867 and 12905, MRT34 and RAIDD, bridging, bridging and also this GO :0070513 : death domain binding, bridging and molecular function this GO :0042981 and regulation of apoptotic process and biological process this GO :0070513 and death domain binding and molecular function this GO :0071260 and cellular response to mechanical stimulus and biological process this GO :2001235 and positive regulation of apoptotic signaling pathway and biological process, nuclei, protein binding, signal transduction by p53 class mediator resulting in cell cycle arrest and biological process this GO :0007165 and signal transduction and biological process this GO :0008625 and extrinsic apoptotic signaling pathway via death domain receptors and biological process this GO :0030674 and protein binding, this GO :0002020 and protease binding and molecular function this GO :0005515 and protein binding and molecular function this GO :0005622 and intracellular and cellular component this GO :0005634 and nucleus and cellular component this GO :0005737 and cytoplasm and cellular component this GO :0006919 and activation of cysteine-type endopeptidase activity involved in apoptotic process and biological process this GO :0006977 and DNA damage response, this GO :0002020 : protease binding, this GO :0002020 : protease binding and also this GO :0005515 : protein binding and also this GO :0030674 : protein binding, this GO :0005515 : protein binding, this GO :0030674 : protein binding, this GO :0070513 : death domain binding, CASP2 and RIPK1 domain containing adaptor with death domain
Identity: 2340
Gene: CRADD | More about : CRADD
Long gene name: CASP2 and RIPK1 domain containing adaptor with death domain
Synonyms: RAIDD
Synonyms name: RIP-associated ICH1/CED3-homologous protein with death domain
Locus: 12q22
Discovery year: 1999-05-07
GenBank acession: U84388
Entrez gene record: 8738
Pubmed identfication: 8985253 9044836
RefSeq identity: NM_003805
Classification: Caspase recruitment domain containing
Havana BLAST/BLAT: OTTHUMG00000170322

Related Products :

CF64 Recombinant Human Death Domain-Containing Protein CRADD, CRADD 500 µg 1755 € novo human
GWB-36BB86 CASP2 And RIPK1 Domain Containing Adaptor With Death Domain (CRADD) Rabbit antibody to or anti-Human Polyclonal (aa99-117) antibody 1 x 1 vial 602 € genways human
GENTAUR-58bdcdb502490 Anti- CASP2 And RIPK1 Domain Containing Adaptor With Death Domain Protein (CRADD) Antibody 100ug 531 € MBS Polyclonals human
GENTAUR-58bdd1044c765 Anti- CASP2 And RIPK1 Domain Containing Adaptor With Death Domain Protein (CRADD) Antibody 50ug 398 € MBS Polyclonals human
GENTAUR-58bdd104a8b4a Anti- CASP2 And RIPK1 Domain Containing Adaptor With Death Domain Protein (CRADD) Antibody 100ug 531 € MBS Polyclonals human
GENTAUR-58bdd75cbdf85 Anti- CASP2 And RIPK1 Domain Containing Adaptor With Death Domain Protein (CRADD) Antibody 100ug 564 € MBS Polyclonals human
MBS619939 Tumor Necrosis Factor Receptor 1-Associated Death Domain Protein Isoform 2 (TRADD, TNFR1-associated DEATH domain protein, TNFRSF1A-associated via death domain, Tumor necrosis factor receptor type 1-associated DEATH domain protein) Antibody 100ug 763 € MBS Polyclonals_1 human
MBS619211 PR Set7 (SET8, SET Domain Containing 8, SET Domain-containing Protein 8, SET Domain Containing Lysine Methyltransferase 8, SET Domain-containing (Lysine Methyltransferase) 8, SETD8, H4 K20 Specific Histone Methyltransferase, H4-K20-HMTase SETD8, PR/SET Do Antibody 100ul 730 € MBS Polyclonals_1 human
MBS620347 SLP-76, NT (SH2 Domain Containing Leukocyte Protein 76 kD, SH2 Domain-containing Leukocyte Protein of 76kD, SH2 Domain Containing Leukocyte Protein of 76kDa, SLP76, SLP76 Tyrosine Phosphoprotein, SLP-76 Tyrosine Phosphoprotein, 76kD Tyrosine Phosphoprotei 100ug 763 € MBS Polyclonals_1 human
MBS619949 Daxx (BING2, DAP 6, DAP6, Death associated protein 6, EAP 1, EAP1, ETS1 associated protein 1, Fas death domain associated protein, hDaxx, MGC126245, MGC126246) Antibody 100ug 785 € MBS Polyclonals_1 human
MBS621984 Daxx, CT (BING2, DAP 6, DAP6, Death associated protein 6, EAP 1, EAP1, ETS1 associated protein 1, Fas death domain associated protein, hDaxx, MGC126245, MGC126246) Antibody 100ug 558 € MBS Polyclonals_1 human
MBS624587 Bad, BH3 Domain (Bcl2 Antagonist Of Cell Death, BAD, Bcl-2-binding Component 6, Bcl-XL/Bcl-2-Associated Death Promoter, Bcl-2-like 8 Protein, BAD, BBC6, BCL2L8) Antibody 200ul 597 € MBS Polyclonals_1 human
MBS622587 SH2 domain protein 2A (SH2D2A, F2771, SCAP, SH2 domain-containing adapter protein, SH2 domain-containing protein 2A, T cell-specific adapter protein, TSAd, TSAD, VEGF receptor-associated protein, VRAP) 100ug 774 € MBS Polyclonals_1 human
MBS622108 GIPC3 (GIPC PDZ Domain Containing Family Member 3, PDZ Domain-containing Protein GIPC3, PDZ Domain Protein GIPC3) Antibody 100ug 735 € MBS Polyclonals_1 human
MBS612590 Rabenosyn 5 (FYVE-finger-containing Rab5 Effector Protein Rabenosyn-5, Zinc Finger FYVE Domain Containing 20, Zinc Finger FYVE Domain-containing Protein 20, ZFYVE20) 100ug 735 € MBS Polyclonals_1 human
MBS619233 SH2D3A (SH2 Domain Containing 3A, Novel SH2-containing Protein 1, NSP1, SH2 Domain-containing Protein 3A, UNQ175/PRO201) 100ug 591 € MBS Polyclonals_1 human
MBS620754 PLEKHB1 (Pleckstrin homology domain containing, family B (evectins) member 1, KPL1, PHR1, PHRET1, PH domain containing protein in retina 1, PH domain containing, retinal 1) 100ug 591 € MBS Polyclonals_1 human
abx262579 Anti-Death Effector Domain Containing Protein (Recombinant) 10 µg 340 € abbex human
MBS616229 CIDE-3 (Cell death activator CIDE-3, Cell death-inducing DFFA-like effector protein C, Fat-specific protein FSP27 homolog, FLJ20871, Fsp27, FSP27) Antibody 100ul 597 € MBS Polyclonals_1 human
MBS621056 DRAK1 (DAP Kinase-related Apoptosis-inducing Protein Kinase 1, Death-associated Protein Kinase-related 1, Serine/threonine Kinase 17a Death Associated Protein Kinase Related 1, STK17A) 100ug 763 € MBS Polyclonals_1 human
MBS623051 CIDE-A (Cell Death-inducing DFFA-like Effector A, Cell Death Activator CIDE-A, CIDEA) Antibody 100ug 857 € MBS Polyclonals_1 human
MBS620344 CIDE-B (Cell Death Inducing DFFA-like Effector B, Cell Death Activator CIDE-B, CIDEB) Antibody 100ug 857 € MBS Polyclonals_1 human
MBS621645 DR6 (Death Receptor 6, BM018, MGC31965, TNFR Related Death Receptor 6, Tumor Necrosis Factor Receptor Superfamily Member 21, Tumor Necrosis Factor Receptor Superfamily Member 21 Precursor, TNFRSF21) Antibody 100ug 564 € MBS Polyclonals_1 human
RP-0480H Recombinant Human CRADD / RAIDD Protein (His Tag) 20μg 572 € adv human
GENTAUR-58bcf3ebbc97c Human Death effector domain-containing protein (DEDD) 100ug 1917 € MBS Recombinant Proteins human
GENTAUR-58bcf3ec11acb Human Death effector domain-containing protein (DEDD) 1000ug 1917 € MBS Recombinant Proteins human
GENTAUR-58bcf3ec46bf6 Human Death effector domain-containing protein (DEDD) 100ug 2431 € MBS Recombinant Proteins human
GENTAUR-58bcf3ecc63dd Human Death effector domain-containing protein (DEDD) 1000ug 2431 € MBS Recombinant Proteins human
GWB-871CC5 Leucine-rich And Death Domain Containing (LRDD) Rabbit antibody to or anti-Human Polyclonal (aa776-910) antibody 1 vial 602 € genways human
GWB-P0230I CRADD, 1-199aa, Recombinant Protein bulk Ask price € genways bulk human