| Reacts with: |
Human |
| Source: |
proteins, Recombinants or rec |
| Description: |
Recombinant Human Insulin-Like Growth Factor II is produced by our E, coli expression system and the target gene encoding Ala25-Glu91 is expressed |
| Molecular Weight: |
8, 91 kD |
| UniProt number: |
P01344 |
| State of the product: |
Freeze-dried |
| Shipping conditions: |
Ambient temperature |
| Formulation: |
pH ~3, 2 um filtered solution of 5 mM Hac, Lyophilized from a 0 |
| Storage recommendations: |
-20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at < |
| Reconstitution: |
Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml |
| Purity: |
and determined by Polyacrylamide gel electrophoresis, Greater than 95% |
| Sequence of the amino acid: |
MFPAMPLSSLFVNAYRPSETLCGGELVDTLQFVCGDRGFYFSRPASRVSRRSRGIVEECCFRSCDLALLETYCATPAKSE |
| Levels of endotoxin: |
11 IEU/ug, LAL test shows less than than 0 |
| Properties: |
Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine, , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp |
| Group: |
recombinants |
| Gene target: |
IGF2, Insulin-Like Growth Factor II |
| Short name: |
IGF2, Recombinant Insulin-Like Growth Factor II |
| Technique: |
E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli |
| Species: |
Humans, Human |
| Alternative name: |
insulin-like growth factor 2 (somatomedin A), sapiens Insulin-Like Growth Factor II, recombinant H |
| Alternative technique: |
rec |
| Alternative to gene target: |
C11orf43 and IGF-II and PP9974, DNA-templated and biological process this GO :0007275 and multicellular organismal development and biological process this GO :0007565 and female pregnancy and biological process this GO :0007596 and blood coagulation and biological process this GO :0007613 and memory and biological process this GO :0008083 and growth factor activity and molecular function this GO :0008284 and positive regulation of cell proliferation and biological process this GO :0008286 and insulin receptor signaling pathway and biological process this GO :0009314 and response to radiation and biological process this GO :0009887 and organ morphogenesis and biological process this GO :0014070 and response to organic cyclic compound and biological process this GO :0030168 and platelet activation and biological process this GO :0030546 and receptor activator activity and molecular function this GO :0031017 and exocrine pancreas development and biological process this GO :0031093 and platelet alpha granule lumen and cellular component this GO :0031667 and response to nutrient levels and biological process this GO :0032355 and response to estradiol and biological process this GO :0035094 and response to nicotine and biological process this GO :0038028 and insulin receptor signaling pathway via phosphatidylinositol 3-kinase and biological process this GO :0042060 and wound healing and biological process this GO :0042104 and positive regulation of activated T cell proliferation and biological process this GO :0042493 and response to drug and biological process this GO :0043085 and positive regulation of catalytic activity and biological process this GO :0043410 and positive regulation of MAPK cascade and biological process this GO :0043539 and protein serine/threonine kinase activator activity and molecular function this GO :0044267 and cellular protein metabolic process and biological process this GO :0045471 and response to ethanol and biological process this GO :0045725 and positive regulation of glycogen biosynthetic process and biological process this GO :0045840 and positive regulation of mitosis and biological process this GO :0045944 and positive regulation of transcription from RNA polymerase II promoter and biological process this GO :0046628 and positive regulation of insulin receptor signaling pathway and biological process this GO :0050731 and positive regulation of peptidyl-tyrosine phosphorylation and biological process this GO :0051146 and striated muscle cell differentiation and biological process this GO :0051781 and positive regulation of cell division and biological process this GO :0051897 and positive regulation of protein kinase B signaling and biological process this GO :0070062 and extracellular vesicular exosome and cellular component this GO :0071260 and cellular response to mechanical stimulus and biological process this GO :0071902 and positive regulation of protein serine/threonine kinase activity and biological process this GO :0090031 and positive regulation of steroid hormone biosynthetic process and biological process this GO :2000273 and positive regulation of receptor activity and biological process this GO :2000467 and positive regulation of glycogen (starch) synthase activity and biological process, Extracellular, IGF2 and IDBG-20829 and ENSG00000167244 and 3481, IGF2 and IDBG-645244 and ENSBTAG00000013066 and 281240, Igf2 and IDBG-212623 and ENSMUSG00000048583 and 16002, protein serine/threonine kinase activator activity, this GO :0001501 and skeletal system development and biological process this GO :0001649 and osteoblast differentiation and biological process this GO :0001934 and positive regulation of protein phosphorylation and biological process this GO :0002576 and platelet degranulation and biological process this GO :0005158 and insulin receptor binding and molecular function this GO :0005159 and insulin-like growth factor receptor binding and molecular function this GO :0005179 and hormone activity and molecular function this GO :0005515 and protein binding and molecular function this GO :0005576 and extracellular region and cellular component this GO :0005615 and extracellular space and cellular component this GO :0005886 and plasma membrane and cellular component this GO :0006006 and glucose metabolic process and biological process this GO :0006349 and regulation of gene expression by genetic imprinting and biological process this GO :0006355 and regulation of transcription, this GO :0005158 : insulin receptor binding, this GO :0005158 : insulin receptor binding and also this GO :0005159 : insulin-like growth factor receptor binding and also this GO :0005179 : hormone activity and also this GO :0005515 : protein binding and also this GO :0008083 : growth factor activity and also this GO :0030546 : receptor activator activity and also this GO :0043539 : protein serine/threonine kinase activator activity, this GO :0005159 : insulin-like growth factor receptor binding, this GO :0005179 : hormone activity, this GO :0005515 : protein binding, this GO :0008083 : growth factor activity, this GO :0030546 : receptor activator activity, this GO :0043539 : protein serine/threonine kinase activator activity, insulin-like growth factor 2 (somatomedin A) |
| Identity: |
5466 |
| Gene: |
IGF2 |
More about : IGF2 |
| Long gene name: |
insulin like growth factor 2 |
| Synonyms gene: |
C11orf43 |
| Synonyms gene name: |
chromosome 11 open reading frame 43 insulin-like growth factor 2 |
| Synonyms: |
FLJ44734 IGF-II |
| Synonyms name: |
somatomedin A preptin |
| Locus: |
11p15, 5 |
| Discovery year: |
2001-06-22 |
| GenBank acession: |
M29645 AK025719 |
| Entrez gene record: |
3481 |
| Pubmed identfication: |
2450353 3167054 |
| RefSeq identity: |
NM_000612 |
| Havana BLAST/BLAT: |
OTTHUMG00000009395 |
| Locus Specific Databases: |
LOVD - Leiden Open Variation Database LRG_1031 |