| Reacts with: |
Human |
| Source: |
proteins, Recombinants or rec |
| Description: |
Recombinant Human Hematopoietic Prostaglandin D Synthase is produced by our E, coli expression system and the target gene encoding Met1-Leu199 is expressed |
| Molecular Weight: |
23, 6 kD |
| UniProt number: |
O60760 |
| State of the product: |
Liquid |
| Shipping conditions: |
Dry Ice/ice packs |
| Formulation: |
200 mM sodium chloride, pH 7, 2 um filtered solution of 20 mM Tris, Supplied as a 0 |
| Storage recommendations: |
-20°, Please minimize freeze-thaw cycles, stable for 6 months after receipt, C, Store at < |
| Reconstitution: |
Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml |
| Purity: |
and determined by Polyacrylamide gel electrophoresis, Greater than 95% |
| Sequence of the amino acid: |
MPNYKLTYFNMRGRAEIIRYIFAYLDIQYEDHRIEQADWPEIKSTLPFGKIPILEVDGLTLHQSLAIARYLTKNTDLAGNTEMEQCHVDAIVDTLDDFMSCFPWAEKKQDVKEQMFNELLTYNAPHLMQDLDTYLGGREWLIGNSVTWADFYWEICSTTLLVFKPDLLDNHPRLVTLRKKVQAIPAVANWIKRRPQTKL |
| Levels of endotoxin: |
11 IEU/ug, LAL test shows less than than 0 |
| Properties: |
Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine, , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp |
| Group: |
recombinants |
| Gene target: |
GSTS, HPGDS, Hematopoietic Prostaglandin D Synthase |
| Short name: |
GSTS, HPGDS, Recombinant Hematopoietic Prostaglandin D Synthase |
| Technique: |
E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli |
| Species: |
Humans, Human |
| Alternative name: |
GSTS, hematopoietic prostaglandin D synthase, sapiens Hematopoietic Prostaglandin D Synthase, recombinant H |
| Alternative technique: |
rec |
| Alternative to gene target: |
Cytoplasm, HPGDS and IDBG-30441 and ENSG00000163106 and 27306, HPGDS and IDBG-641077 and ENSBTAG00000017073 and 100139892, Hpgds and IDBG-153041 and ENSMUSG00000029919 and 54486, protein homodimerization activity, this GO :0000287 and magnesium ion binding and molecular function this GO :0004364 and glutathione transferase activity and molecular function this GO :0004667 and prostaglandin-D synthase activity and molecular function this GO :0005509 and calcium ion binding and molecular function this GO :0005515 and protein binding and molecular function this GO :0005737 and cytoplasm and cellular component this GO :0005829 and cytosol and cellular component this GO :0006693 and prostaglandin metabolic process and biological process this GO :0006805 and xenobiotic metabolic process and biological process this GO :0007165 and signal transduction and biological process this GO :0007626 and locomotory behavior and biological process this GO :0019369 and arachidonic acid metabolic process and biological process this GO :0019371 and cyclooxygenase pathway and biological process this GO :0042803 and protein homodimerization activity and molecular function this GO :0044281 and small molecule metabolic process and biological process this GO :1901687 and glutathione derivative biosynthetic process and biological process, this GO :0000287 : magnesium ion binding, this GO :0000287 : magnesium ion binding and also this GO :0004364 : glutathione transferase activity and also this GO :0004667 : prostaglandin-D synthase activity and also this GO :0005509 : calcium ion binding and also this GO :0005515 : protein binding and also this GO :0042803 : protein homodimerization activity, this GO :0004364 : glutathione transferase activity, this GO :0004667 : prostaglandin-D synthase activity, this GO :0005509 : calcium ion binding, this GO :0005515 : protein binding, this GO :0042803 : protein homodimerization activity, hematopoietic prostaglandin D synthase |
| Identity: |
17890 |
| Gene: |
HPGDS |
More about : HPGDS |
| Long gene name: |
hematopoietic prostaglandin D synthase |
| Synonyms: |
GSTS PGDS H-PGDS PGD2 GSTS1-1 GSTS1 |
| Synonyms name: |
glutathione S-transferase sigma |
| Locus: |
4q22, 3 |
| Discovery year: |
2009-07-14 |
| GenBank acession: |
D82073 |
| Entrez gene record: |
27306 |
| Pubmed identfication: |
9323136 9353279 11672424 |
| RefSeq identity: |
NM_014485 |
| Classification: |
Glutathione S-transferases |
| Havana BLAST/BLAT: |
OTTHUMG00000130974 |