Recombinant Human Autophagy Related 4 Homolog A, ATG4A (N-6His)

Contact us
Catalog number: CF50
Price: 636 €
Supplier: MBS Polyclonals_1
Product name: Recombinant Human Autophagy Related 4 Homolog A, ATG4A (N-6His)
Quantity: 100ul
Other quantities: 1 mg 2486€ 10 µg 202€ 50 µg 496€
Related search:

More details :

Reacts with: Human
Source: proteins, Recombinants or rec
Description: Recombinant Human Autophagy protein 4A is produced by our E, coli expression system and the target gene encoding Met1-Val398 is expressed with a 6His tag at the N-terminus
Molecular Weight: 47, 5 kD
UniProt number: Q8WYN0
State of the product: Liquid
Shipping conditions: Dry Ice/ice packs
Formulation: 150 mM sodium chloride,pH7, 2 um filtered solution of 20 mM PB, 4, Supplied as a 0
Storage recommendations: -20°, Please minimize freeze-thaw cycles, stable for 6 months after receipt, C, Store at <
Reconstitution: Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml
Purity: and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid: MGSSHHHHHHSSGLVPRGSHMESVLSKYEDQITIFTDYLEEYPDTDELVWILGKQHLLKTEKSKLLSDISARLWFTYRRKFSPIGGTGPSSDAGWGCMLRCGQMMLAQALICRHLGRDWSWEKQKEQPKEYQRILQCFLDRKDCCYSIHQMAQMGVGEGKSIGEWFGPNTVAQVLKKLALFDEWNSLAVYVSMDNTVVIEDIKKMCRVLPLSADTAGDRPPDSLTASNQSKGTSAYCSAWKPLLLIVPLRLGINQINPVYVDAFKECFKMPQSLGALGGKPNNAYYFIGFLGDELIFLDPHTTQTFVDTEENGTVNDQTFHCLQSPQRMNILNLDPSVALGFFCKEEKDFDNWCSLVQKEILKENLRMFELVQKHPSHWPPFVPPAKPEVTTTGAEFIDSTEQLEEFDLEEDFEILSV
Levels of endotoxin: 11 IEU/ug, LAL test shows less than than 0
Properties: Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp
Group: recombinants
Gene target: ATG4A (N-6His), Autophagy Related 4 Homolog A
Short name: ATG4A (N-6His), Recombinant Autophagy 4 Homolog A
Technique: E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Species: Humans, Human
Alternative name: ATG4A (N-6His), sapiens Autophagy Related 4 Homolog A, recombinant H
Alternative technique: rec
Identity: 16489
Gene: ATG4A | More about : ATG4A
Long gene name: autophagy related 4A cysteine peptidase
Synonyms gene: AUTL2 APG4A
Synonyms gene name: AUT-like 2, cerevisiae) APG4 autophagy 4 homolog A (S, cerevisiae) ATG4 autophagy related 4 homolog A (S, cerevisiae) autophagy related 4A, cysteine endopeptidase (S, cysteine peptidase
Locus: Xq22, 3
Discovery year: 2001-12-05
GenBank acession: AJ320508
Entrez gene record: 115201
Pubmed identfication: 12446702 12473658
RefSeq identity: NM_052936
Classification: Autophagy related
Havana BLAST/BLAT: OTTHUMG00000022176

Related Products :

MBS618214 Atg4A (ATG4A, Autophagy Related Protein 4 Homolog A, Autophagin 2) Antibody 100ug 774 € MBS Polyclonals_1 human
CF50 Recombinant Human Autophagy Related 4 Homolog A, ATG4A (N-6His) 50 µg 496 € novo human
MBS612223 APG5 (APG5 Autophagy 5-like, APG5-like, APG5L, Apoptosis-specific Protein, ASP, ATG5 Autophagy-related 5 Homolog, Autophagy Protein 5, hAPG5, Homolog of S Cerevisiae Autophagy 5) Antibody 100ul 564 € MBS Polyclonals_1 human
MBS616231 Atg16L1 (Autophagy-related Protein 16-1, ATG16 Autophagy Related 16-like 1, APG16-like 1, APG16 Autophagy 16-like 1) Antibody 100ul 652 € MBS Polyclonals_1 human
GENTAUR-58bc46d615dac Oryza sativa subsp. indica Cysteine protease ATG4A (ATG4A) 100ug 2315 € MBS Recombinant Proteins human
GENTAUR-58bc46d660c46 Oryza sativa subsp. indica Cysteine protease ATG4A (ATG4A) 1000ug 2315 € MBS Recombinant Proteins human
GENTAUR-58bc46d6ad889 Oryza sativa subsp. indica Cysteine protease ATG4A (ATG4A) 100ug 2829 € MBS Recombinant Proteins human
GENTAUR-58bc46d6f28de Oryza sativa subsp. indica Cysteine protease ATG4A (ATG4A) 1000ug 2829 € MBS Recombinant Proteins human
GENTAUR-58bd8ea036c17 Oryza sativa subsp. japonica Cysteine protease ATG4A (ATG4A) 100ug 2315 € MBS Recombinant Proteins human
GENTAUR-58bd8ea0a44f1 Oryza sativa subsp. japonica Cysteine protease ATG4A (ATG4A) 1000ug 2315 € MBS Recombinant Proteins human
GENTAUR-58bd8ea1166aa Oryza sativa subsp. japonica Cysteine protease ATG4A (ATG4A) 100ug 2829 € MBS Recombinant Proteins human
GENTAUR-58bd8ea194085 Oryza sativa subsp. japonica Cysteine protease ATG4A (ATG4A) 1000ug 2829 € MBS Recombinant Proteins human
MBS618761 Atg3 (Autophagy-related Protein 3, APG3, ATG3 Autophagy Related 3 Homolog (S. cerevisiae), APG3-like, AUT1, Protein PC3-96) Antibody 100ul 652 € MBS Polyclonals_1 human
MBS612220 Atg4B (Cysteine Protease ATG4B, Autophagy-related Protein 4 Homolog B, Autophagin-1, Autophagy-related Cysteine Endopeptidase 1, AUT-like 1 Cysteine Endopeptidase, APG4B, AUTL1, KIAA0943) Antibody 100ul 652 € MBS Polyclonals_1 human
MBS612897 Atg4C (Apg4c, Autl3, Cysteine Protease ATG4C, Autophagy-related Protein 4 Homolog C, Autophagin-3, Autophagy-related Cysteine Endopeptidase 3, AUT-like 3 Cysteine Endopeptidase) Antibody 100ul 652 € MBS Polyclonals_1 human
MBS619226 ATG4D (ATG4 Autophagy Related 4 Homolog D, PG4D, APG4-D, AUTL4, AUT-like 4 Cysteine Endopeptidase, Autophagin-4, Autophagy-related Cysteine Endopeptidase 4, Autophagy-related Protein 4 Homolog D, Cysteine Protease ATG4D) 100ug 509 € MBS Polyclonals_1 human
MBS619934 ATG7 (APG7-Like, APG7L, ATG7 Autophagy-related 7 Homolog (S. cerevisiae), Autophagy Related Protein 7, DKFZp434N0735, GSA7, hAGP7, Ubiquitin Activating Enzyme E1-like Protein) Antibody 50ug 928 € MBS Polyclonals_1 human
MBS612054 Apg12 (Autophagy-related 12, 4931423H11Rik, A330058M13Rik, Atg12, Apg12L, APG12-like, Atg12L, Autophagy-related protein 12) Antibody 100ul 564 € MBS Polyclonals_1 human
MBS612797 Apg12 (Autophagy-related 12, 4931423H11Rik, A330058M13Rik, Atg12, Apg12L, APG12-like, Atg12L, Autophagy-related protein 12) Antibody 100ul 652 € MBS Polyclonals_1 human
MBS616373 Apg12 (Autophagy-related 12, 4931423H11Rik, A330058M13Rik, Atg12, Apg12L, APG12-like, Atg12L, Autophagy-related protein 12) Antibody 100ug 663 € MBS Polyclonals_1 human
MBS616735 Apg12 (Autophagy-related 12, 4931423H11Rik, A330058M13Rik, Atg12, Apg12L, APG12-like, Atg12L, Autophagy-related protein 12) Antibody 500ug 652 € MBS Polyclonals_1 human
MBS617427 Apg12 (Autophagy-related 12, 4931423H11Rik, A330058M13Rik, Atg12, Apg12L, APG12-like, Atg12L, Autophagy-related protein 12) Antibody 0.25 miligrams 641 € MBS Polyclonals_1 human
MBS618240 Apg12 (Autophagy-related 12, 4931423H11Rik, A330058M13Rik, Atg12, Apg12L, APG12-like, Atg12L, Autophagy-related protein 12) Antibody 100ul 564 € MBS Polyclonals_1 human
MBS620931 Apg12 (Autophagy-related 12, 4931423H11Rik, A330058M13Rik, Atg12, Apg12L, APG12-like, Atg12L, Autophagy-related protein 12) Antibody 100ug 564 € MBS Polyclonals_1 human
MBS622327 Apg12 (Autophagy-related 12, 4931423H11Rik, A330058M13Rik, Atg12, Apg12L, APG12-like, Atg12L, Autophagy-related protein 12) Antibody 100ug 674 € MBS Polyclonals_1 human
MBS620694 Apg12, IN (Autophagy-related 12, 4931423H11Rik, A330058M13Rik, Atg12, Apg12L, APG12-like, Atg12L, Autophagy-related protein 12) Antibody 100ug 569 € MBS Polyclonals_1 human
MBS622859 Apg12, NT (Autophagy-related 12, 4931423H11Rik, A330058M13Rik, Atg12, Apg12L, APG12-like, Atg12L, Autophagy-related protein 12) Antibody 100ug 569 € MBS Polyclonals_1 human
MBS618594 Atg8 (apg8, Autophagy-related Protein 8, ATG8, Autophagy-related Ubiquitin-like Modifier Apg8, Cytoplasm to Vacuole Targeting Protein 5) Antibody 500ug 829 € MBS Polyclonals_1 human
MBS611747 MAP1LC3A, NT (Microtubule Associated Protein 1 Light Chain 3 alpha, MAP1 Light Chain 3A, APG8, Autophagy Related Protein LC3A, Autophagy Related Ubiquitin-like Modifier LC3A, LC3A, MAP1 Light Chain 3 Like Protein 1, Microtubule Associated Proteins 1A/1B L Antibody 100ul 652 € MBS Polyclonals_1 human
MBS613995 MAP1LC3B (LC3B, Autophagy Related Protein LC3B, Autophagy Related Ubiquitin-like Modifier LC3B, MAP1 Light Chain 3-like Protein 2, Microtubule Associated Proteins 1A/1B Light Chain 3B, MAP1A/1B Light Chain 3B, MAP1A/MAP1B LC3B, Microtubule Associated Prot Antibody 100ul 636 € MBS Polyclonals_1 human