| Reacts with: |
Human |
| Source: |
proteins, Recombinants or rec |
| Description: |
Recombinant Human PHLDA2 is produced by our E, coli expression system and the target gene encoding Met1-Pro152 is expressed with a 6His tag at the C-terminus |
| Molecular Weight: |
1 kD, 18 |
| UniProt number: |
Q53GA4 |
| State of the product: |
Freeze-dried |
| Shipping conditions: |
Ambient temperature |
| Formulation: |
0, 1 mM DTT, pH 8, 1M sodium chloride, 2 um filtered solution of 20 mM Tris, Lyophilized from a 0 |
| Storage recommendations: |
-20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at < |
| Reconstitution: |
Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml |
| Purity: |
and determined by Polyacrylamide gel electrophoresis, Greater than 95% |
| Sequence of the amino acid: |
MKSPDEVLREGELEKRSDSLFQLWKKKRGVLTSDRLSLFPASPRARPKELRFHSILKVDCVERTGKYVYFTIVTTDHKEIDFRCAGESCWNAAIALALIDFQNRRALQDFRSRQERTAPAAPAEDAVAAAAAAPSEPSEPSRPSPQPKPRTPLEHHHHHH |
| Levels of endotoxin: |
11 IEU/ug, LAL test shows less than than 0 |
| Properties: |
Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine, , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp |
| Group: |
recombinants |
| Gene target: |
BWR1C, IPL, PHLDA2, TSSC3 (C-6His), PH-Like Domain A2 |
| Short name: |
BWR1C, IPL, PHLDA2, TSSC3 (C-6His), Recombinant PH-Like Domain A2 |
| Technique: |
E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli |
| Species: |
Humans, Human |
| Alternative name: |
BWR1C, IPL, TSSC3 (C-6His), family A, member 2, pleckstrin homology-like domain, sapiens PH-Like Domain A2, recombinant H |
| Alternative technique: |
rec |
| Alternative to gene target: |
BRW1C and BWR1C and HLDA2 and IPL and TSSC3, PHLDA2 and IDBG-23772 and ENSG00000181649 and 7262, PHLDA2 and IDBG-645159 and ENSBTAG00000031194 and 618810, Phlda2 and IDBG-212749 and ENSMUSG00000010760 and 22113, Plasma membranes, family A, member 2, this GO :0001890 and placenta development and biological process this GO :0005737 and cytoplasm and cellular component this GO :0006915 and apoptotic process and biological process this GO :0009887 and organ morphogenesis and biological process this GO :0010468 and regulation of gene expression and biological process this GO :0016020 and membrane and cellular component this GO :0030334 and regulation of cell migration and biological process this GO :0045995 and regulation of embryonic development and biological process this GO :0070873 and regulation of glycogen metabolic process and biological process, pleckstrin homology-like domain |
| Identity: |
12385 |
| Gene: |
PHLDA2 |
More about : PHLDA2 |
| Long gene name: |
pleckstrin homology like domain family A member 2 |
| Synonyms gene: |
TSSC3 |
| Synonyms gene name: |
family A, member 2 , tumor suppressing subtransferable candidate 3 pleckstrin homology-like domain |
| Synonyms: |
IPL BWR1C HLDA2 |
| Locus: |
11p15, 4 |
| Discovery year: |
1998-06-22 |
| GenBank acession: |
AF035444 |
| Entrez gene record: |
7262 |
| Pubmed identfication: |
9328465 9403053 |
| RefSeq identity: |
NM_003311 |
| Classification: |
Pleckstrin homology domain containing |
| Havana BLAST/BLAT: |
OTTHUMG00000010926 |
| Locus Specific Databases: |
LRG_1043 |