Recombinant Human Ribulose-Phosphate 3-Epimerase, RPE (C-6His)

Contact us
Catalog number: CF37
Price: 1658 €
Supplier: MBS Recombinant Proteins
Product name: Recombinant Human Ribulose-Phosphate 3-Epimerase, RPE (C-6His)
Quantity: 100ug
Other quantities: 10 µg 156€ 50 µg 369€ 500 µg 1613€
Related search:

More details :

Reacts with: Human
Source: proteins, Recombinants or rec
Description: Recombinant Human Ribulose-Phosphate 3-Epimerase is produced by our E, coli expression system and the target gene encoding Met1-Arg228 is expressed with a 6His tag at the C-terminus
Molecular Weight: 25, 9 kD
UniProt number: Q96AT9-1
State of the product: Liquid
Shipping conditions: Dry Ice/ice packs
Formulation: 150 mM sodium chloride, pH 6, 2, 2 um filtered solution of 20 mM PB, Supplied as a 0
Storage recommendations: -20°, Please minimize freeze-thaw cycles, stable for 6 months after receipt, C, Store at <
Reconstitution: Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml
Purity: and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid: MASGCKIGPSILNSDLANLGAECLRMLDSGADYLHLDVMDGHFVPNITFGHPVVESLRKQLGQDPFFDMHMMVSKPEQWVKPMAVAGANQYTFHLEATENPGALIKDIRENGMKVGLAIKPGTSVEYLAPWANQIDMALVMTVEPGFGGQKFMEDMMPKVHWLRTQFPSLDIEVDGGVGPDTVHKCAEAGANMIVSGSAIMRSEDPRSVINLLRNVCSEAAQKRSLDRVDHHHHHH
Levels of endotoxin: 11 IEU/ug, LAL test shows less than than 0
Properties: Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp
Group: recombinants
Gene target: RPE (C-6His), Ribulose-Phosphate 3-Epimerase
Short name: RPE (C-6His), Recombinant Ribulose-Phosphate 3-Epimerase
Technique: E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Species: Humans, Human
Alternative name: RPE (C-6His), sapiens Ribulose-Phosphate 3-Epimerase, recombinant H
Alternative technique: rec
Identity: 10293
Gene: RPE | More about : RPE
Long gene name: ribulose-5-phosphate-3-epimerase
Locus: 2q34
Discovery year: 2001-06-22
Entrez gene record: 6120
RefSeq identity: NM_006916
Havana BLAST/BLAT: OTTHUMG00000154690

Related Products :

CF37 Recombinant Human Ribulose-Phosphate 3-Epimerase, RPE (C-6His) 500 µg 1613 € novo human
GENTAUR-58b8ae9d5a3cf Bacillus subtilis Ribulose-phosphate 3-epimerase (rpe) 100ug 1658 € MBS Recombinant Proteins human
GENTAUR-58b8ae9da8a87 Bacillus subtilis Ribulose-phosphate 3-epimerase (rpe) 1000ug 1658 € MBS Recombinant Proteins human
GENTAUR-58b8ae9dd96c0 Bacillus subtilis Ribulose-phosphate 3-epimerase (rpe) 100ug 2172 € MBS Recombinant Proteins human
GENTAUR-58b8ae9e2e717 Bacillus subtilis Ribulose-phosphate 3-epimerase (rpe) 1000ug 2172 € MBS Recombinant Proteins human
GENTAUR-58b8e7a253121 Buchnera aphidicola subsp. Acyrthosiphon pisum Ribulose-phosphate 3-epimerase (rpe) 100ug 1685 € MBS Recombinant Proteins human
GENTAUR-58b8e7a2b8be3 Buchnera aphidicola subsp. Acyrthosiphon pisum Ribulose-phosphate 3-epimerase (rpe) 1000ug 1685 € MBS Recombinant Proteins human
GENTAUR-58b8e7a31403f Buchnera aphidicola subsp. Acyrthosiphon pisum Ribulose-phosphate 3-epimerase (rpe) 100ug 2199 € MBS Recombinant Proteins human
GENTAUR-58b8e7a381d99 Buchnera aphidicola subsp. Acyrthosiphon pisum Ribulose-phosphate 3-epimerase (rpe) 1000ug 2199 € MBS Recombinant Proteins human
GENTAUR-58b9e3cc91a32 Buchnera aphidicola subsp. Acyrthosiphon pisum Ribulose-phosphate 3-epimerase (rpe) 100ug 1685 € MBS Recombinant Proteins human
GENTAUR-58b9e3ccdc8c9 Buchnera aphidicola subsp. Acyrthosiphon pisum Ribulose-phosphate 3-epimerase (rpe) 1000ug 1685 € MBS Recombinant Proteins human
GENTAUR-58b9e3cd377cd Buchnera aphidicola subsp. Acyrthosiphon pisum Ribulose-phosphate 3-epimerase (rpe) 100ug 2199 € MBS Recombinant Proteins human
GENTAUR-58b9e3ce10207 Buchnera aphidicola subsp. Acyrthosiphon pisum Ribulose-phosphate 3-epimerase (rpe) 1000ug 2199 € MBS Recombinant Proteins human
GENTAUR-58b9c644e70cd Chlamydia trachomatis Ribulose-phosphate 3-epimerase (rpe) 100ug 1702 € MBS Recombinant Proteins chlamydia
GENTAUR-58b9c64565f80 Chlamydia trachomatis Ribulose-phosphate 3-epimerase (rpe) 1000ug 1702 € MBS Recombinant Proteins chlamydia
GENTAUR-58b9c645c3c2c Chlamydia trachomatis Ribulose-phosphate 3-epimerase (rpe) 100ug 2210 € MBS Recombinant Proteins chlamydia
GENTAUR-58b9c6462eebe Chlamydia trachomatis Ribulose-phosphate 3-epimerase (rpe) 1000ug 2210 € MBS Recombinant Proteins chlamydia
GENTAUR-58baf0896d2ca Escherichia coli Ribulose-phosphate 3-epimerase (rpe) 100ug 1680 € MBS Recombinant Proteins human
GENTAUR-58baf08a2db45 Escherichia coli Ribulose-phosphate 3-epimerase (rpe) 1000ug 1680 € MBS Recombinant Proteins human
GENTAUR-58baf08b078eb Escherichia coli Ribulose-phosphate 3-epimerase (rpe) 100ug 2194 € MBS Recombinant Proteins human
GENTAUR-58baf08b5a6e2 Escherichia coli Ribulose-phosphate 3-epimerase (rpe) 1000ug 2194 € MBS Recombinant Proteins human
GENTAUR-58bb1d6208c0c Escherichia coli Ribulose-phosphate 3-epimerase (rpe) 100ug 1680 € MBS Recombinant Proteins human
GENTAUR-58bb1d624d3cb Escherichia coli Ribulose-phosphate 3-epimerase (rpe) 1000ug 1680 € MBS Recombinant Proteins human
GENTAUR-58bb1d628578d Escherichia coli Ribulose-phosphate 3-epimerase (rpe) 100ug 2194 € MBS Recombinant Proteins human
GENTAUR-58bb1d62cae0c Escherichia coli Ribulose-phosphate 3-epimerase (rpe) 1000ug 2194 € MBS Recombinant Proteins human
GENTAUR-58bb7991042f2 Haemophilus influenzae Ribulose-phosphate 3-epimerase (rpe) 100ug 1674 € MBS Recombinant Proteins human
GENTAUR-58bb79915802b Haemophilus influenzae Ribulose-phosphate 3-epimerase (rpe) 1000ug 1674 € MBS Recombinant Proteins human
GENTAUR-58bb79919d123 Haemophilus influenzae Ribulose-phosphate 3-epimerase (rpe) 100ug 2188 € MBS Recombinant Proteins human
GENTAUR-58bb7991d5e6e Haemophilus influenzae Ribulose-phosphate 3-epimerase (rpe) 1000ug 2188 € MBS Recombinant Proteins human
GENTAUR-58bc51e2c43e2 Helicobacter pylori Ribulose-phosphate 3-epimerase (rpe) 100ug 1658 € MBS Recombinant Proteins helicobacter