Recombinant Human dUTP Pyrophosphatase, dUTPase

Contact us
Catalog number: CF33
Price: 293 €
Supplier: biotiom
Product name: Recombinant Human dUTP Pyrophosphatase, dUTPase
Quantity: 50 µL
Other quantities: 1 mg 2283€ 10 µg 146€ 50 µg 339€ 500 µg 1613€
Related search:

More details :

Reacts with: Human
Source: proteins, Recombinants or rec
Description: Recombinant Human dUTP Pyrophosphatase is produced by our E, coli expression system and the target gene encoding Met1-Asn164 is expressed
Molecular Weight: 17, 7 kD
UniProt number: P33316-2
State of the product: Liquid
Shipping conditions: Dry Ice/ice packs
Formulation: 150 mM sodium chloride, 2 um filtered solution of 20 mM PB, 4, Supplied as a 0, pH7
Storage recommendations: -20°, Please minimize freeze-thaw cycles, stable for 6 months after receipt, C, Store at <
Reconstitution: Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml
Purity: and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid: MPCSEETPAISPSKRARPAEVGGMQLRFARLSEHATAPTRGSARAAGYDLYSAYDYTIPPMEKAVVKTDIQIALPSGCYGRVAPRSGLAAKHFIDVGAGVIDEDYRGNVGVVLFNFGKEKFEVKKGDRIAQLICERIFYPEIEEVQALDDTERGSGGFGSTGKN
Levels of endotoxin: 11 IEU/ug, LAL test shows less than than 0
Properties: Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp
Group: recombinants
Gene target: dUTPase, dUTP Pyrophosphatase
Short name: dUTPase, Recombinant dUTP Pyrophosphatase
Technique: E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Species: Humans, Human
Alternative name: dUTPase, sapiens dUTP Pyrophosphatase, recombinant H
Alternative technique: rec

Related Products :

CF33 Recombinant Human dUTP Pyrophosphatase, dUTPase 50 µg 339 € novo human
CF34 Recombinant Human dUTP Pyrophosphatase, dUTPase 1 mg 2486 € novo human
MBS620729 Deoxyuridine Triphosphatase (DUT, dUTP Pyrophosphatase, dUTPase, Deoxyuridine 5'-triphosphate Nucleotidohydrolase Mitochondrial, FLJ20622) Antibody 100ug 652 € MBS Polyclonals_1 human
MBS620346 DUT (dUTP pyrophosphatase) Antibody 50ug 625 € MBS Polyclonals_1 human
RP-370 Recombinant (E.Coli) Thermostable dUTPase 50 IU 478 € adi human
MBS242267 Chicken Polyclonal (IgY) to Human DUT / DUTPase Antibody 50ug 597 € MBS Polyclonals_1 human
GENTAUR-58bde752216b4 Mouse Monoclonal [clone 1C9] (IgG1,k) to Human DUT / DUTPase Antibody 50ug 663 € MBS mono human
GENTAUR-58be5fbeea3e3 Anti-dUTPase (Polyclonal), ALEXA Fluor 594 100 microliters 489 € Bioss Polyclonal Antibodies human
MBS610114 Deoxyuridine Triphosphate Nucleotidohydrolase (DUT-N, dUTPase) Antibody 200ul 558 € MBS Polyclonals_1 human
bs-1721R-A350 dUTPase Antibody, ALEXA FLUOR 350 100ul 332 € Bioss Primary Conjugated Antibodies. human
bs-1721R-A488 dUTPase Antibody, ALEXA FLUOR 488 100ul 332 € Bioss Primary Conjugated Antibodies. human
bs-1721R-A555 dUTPase Antibody, ALEXA FLUOR 555 100ul 332 € Bioss Primary Conjugated Antibodies. human
bs-1721R-A594 dUTPase Antibody, ALEXA FLUOR 594 100ul 332 € Bioss Primary Conjugated Antibodies. human
bs-1721R-A647 dUTPase Antibody, ALEXA FLUOR 647 100ul 332 € Bioss Primary Conjugated Antibodies. human
bs-1721R-Biotin dUTPase Antibody, Biotin Conjugated 0.1ml 333 € Bioss Primary Conjugated Antibodies human
bs-1721R dUTPase Antibody 0.1ml 263 € Bioss Primary Unconjugated Antibodies human
bs-1721R-Cy3 dUTPase Antibody, Cy3 Conjugated 0.1ml 350 € Bioss Primary Conjugated Antibodies human
bs-1721R-Cy5 dUTPase Antibody, Cy5 Conjugated 0.1ml 350 € Bioss Primary Conjugated Antibodies human
bs-1721R-Cy5.5 dUTPase Antibody, Cy5.5 Conjugated 0.1ml 350 € Bioss Primary Conjugated Antibodies human
bs-1721R-Cy7 dUTPase Antibody, Cy7 Conjugated 0.1ml 350 € Bioss Primary Conjugated Antibodies human
bs-1721R-FITC dUTPase Antibody, FITC Conjugated 0.1ml 333 € Bioss Primary Conjugated Antibodies human
bs-1721R-HRP dUTPase Antibody, HRP Conjugated 0.1ml 350 € Bioss Primary Conjugated Antibodies human
MBS175515 Polyclonal Anti-dUTPase 100ug 326 € MBS Polyclonals_1 human
GWB-BBP050 Polyclonal antibody to or anti-dUTPase antibody 1 vial 463 € genways human
40020 5-AMINOALLYL-DUTP, SODIUM SALT, 10 MM IN 100 µL 204 € biotiom human
40020-1 5-AMINOALLYL-DUTP, SODIUM SALT, LYOPHILI 1 MG 237 € biotiom human
40001 5-Tetramethylrhodamine-dUTP, 1mM in pH=7.5 Tris-HCl buffer 25 µL 184 € biotiom human
40029 BIOTIN-11-DUTP, 1 MM IN PH 7.5 TRIS-HCL 50 µL 293 € biotiom human
40029-1 BIOTIN-11-DUTP, LYOPHILIZED POWDER (BIOT 50 µG 293 € biotiom human
40022 BIOTIN-16-DUTP, 1 MM IN PH 7.5 TRIS-HCL 50 µL 293 € biotiom human