| Reacts with: |
Human |
| Source: |
proteins, Recombinants or rec |
| Description: |
T7 tag at the N-terminus, Recombinant Human Deoxycytidine Kinase is produced by our E, coli expression system and the target gene encoding Met1-Leu260 is expressed with a 6His |
| Molecular Weight: |
34 kD |
| UniProt number: |
P27707 |
| State of the product: |
Liquid |
| Shipping conditions: |
Dry Ice/ice packs |
| Formulation: |
2 um filtered solution of 20 mM TrisHCl，pH7, 5, Supplied as a 0 |
| Storage recommendations: |
-20°, Please minimize freeze-thaw cycles, stable for 6 months after receipt, C, Store at < |
| Reconstitution: |
Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml |
| Purity: |
and determined by Polyacrylamide gel electrophoresis, Greater than 95% |
| Sequence of the amino acid: |
MGSSHHHHHHSSGLVPRGSHMASMTGGQQMGRGSMATPPKRSCPSFSASSEGTRIKKISIEGNIAAGKSTFVNILKQLCEDWEVVPEPVARWCNVQSTQDEFEELTMSQKNGGNVLQMMYEKPERWSFTFQTYACLSRIRAQLASLNGKLKDAEKPVLFFERSVYSDRYIFASNLYESECMNETEWTIYQDWHDWMNNQFGQSLELDGIIYLQATPETCLHRIYLRGRNEEQGIPLEYLEKLHYKHESWLLHRTLKTNFDYLQEVPILTLDVNEDFKDKYESLVEKVKEFLSTL |
| Levels of endotoxin: |
11 IEU/ug, LAL test shows less than than 0 |
| Properties: |
Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine, , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp |
| Group: |
recombinants |
| Gene target: |
DCK (N-6His, T7 tag), Deoxycytidine Kinase |
| Short name: |
DCK (N-6His, T7 tag), Recombinant Deoxycytidine Kinase |
| Technique: |
E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli |
| Label: |
tag |
| Species: |
Humans, Human |
| Alternative name: |
DCK (N-6His, T7 detection labelled), sapiens Deoxycytidine phosphorylation catalyst, recombinant H |
| Alternative technique: |
rec |
| Identity: |
2704 |
| Gene: |
DCK |
More about : DCK |
| Long gene name: |
deoxycytidine kinase |
| Locus: |
4q13, 3 |
| Discovery year: |
1991-08-08 |
| GenBank acession: |
M60527 |
| Entrez gene record: |
1633 |
| Pubmed identfication: |
8406512 |
| Havana BLAST/BLAT: |
OTTHUMG00000129908 |