Recombinant Human Carbonic Anhydrase 10, CA10 (N-6His)

Contact us
Catalog number: CE99
Price: 110 €
Supplier: novo
Product name: Recombinant Human Carbonic Anhydrase 10, CA10 (N-6His)
Quantity: 10 µg
Other quantities: 1 mg 2283€ 10 µg 156€ 500 µg 1613€
Related search:

More details :

Reacts with: Human
Source: proteins, Recombinants or rec
Description: Recombinant Human Carbonic Anhydrase 10 is produced by our E, coli expression system and the target gene encoding Ala21-Asn300 is expressed with a 6His tag at the N-terminus
Molecular Weight: 1 kD, 34
UniProt number: Q9NS85
State of the product: Freeze-dried
Shipping conditions: Ambient temperature
Formulation: 150 mM sodium chloride, pH 7, 2 um filtered solution of 25 mM Tris, 5, Lyophilized from a 0
Storage recommendations: -20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at <
Reconstitution: Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml
Purity: and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid: MNHKVHHHHHHMAQQNSPKIHEGWWAYKEVVQGSFVPVPSFWGLVNSAWNLCSVGKRQSPVNIETSHMIFDPFLTPLRINTGGRKVSGTMYNTGRHVSLRLDKEHLVNISGGPMTYSHRLEEIRLHFGSEDSQGSEHLLNGQAFSGEVQLIHYNHELYTNVTEAAKSPNGLVVVSIFIKVSDSSNPFLNRMLNRDTITRITYKNDAYLLQGLNIEELYPETSSFITYDGSMTIPPCYETASWIIMNKPVYITRMQMHSLRLLSQNQPSQIFLSMSDNFRPVQPLNNRCIRTNLELQSR
Levels of endotoxin: 11 IEU/ug, LAL test shows less than than 0
Properties: Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp
Group: recombinants
Gene target: CA10 (N-6His), Carbonic Anhydrase 10
Short name: CA10 (N-6His), Recombinant Carbonic Anhydrase 10
Technique: E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Species: Humans, Human
Alternative name: CA10 (N-6His), sapiens Carbonic Anhydrase 10, recombinant H
Alternative technique: rec
Identity: 1369
Gene: CA10 | More about : CA10
Long gene name: carbonic anhydrase 10
Synonyms gene name: carbonic anhydrase X
Synonyms: CARPX CA-RPX HUCEP-15
Locus: 17q21, 33-q22
Discovery year: 1998-07-17
GenBank acession: AF288385
Entrez gene record: 56934
Pubmed identfication: 8673298 9921901
RefSeq identity: NM_020178
Classification: Carbonic anhydrases
Havana BLAST/BLAT: OTTHUMG00000177544

Related Products :

C305 Recombinant Human Carbonic Anhydrase 10, CA10 (C-6His) 1 mg 2283 € novo human
CE99 Recombinant Human Carbonic Anhydrase 10, CA10 (N-6His) 500 µg 1613 € novo human
RP-0201H Recombinant Human Carbonic Anhydrase X / CA10 Protein 10μg 572 € adv human
RP-0200H Recombinant Human Carbonic Anhydrase X / CA10 Protein (His Tag) 10μg 572 € adv human
MBS624510 CA9, ID (Carbonic Anhydrase 9, Carbonic Anhydrase IX, Carbonate Dehydratase IX, CA-IX, CAIX, Membrane Antigen MN, P54/58N, Renal Cell Carcinoma-associated Antigen G250, RCC-associated Antigen G250, pMW1, G250, MN) Antibody 200ul 603 € MBS Polyclonals_1 human
MBS623542 CA9, NT (Carbonic Anhydrase 9, Carbonic Anhydrase IX, Carbonate Dehydratase IX, CA-IX, CAIX, Membrane Antigen MN, P54/58N, Renal Cell Carcinoma-associated Antigen G250, RCC-associated Antigen G250, pMW1, G250, MN) Antibody 200ul 603 € MBS Polyclonals_1 human
GENTAUR-58be5bc4372f7 Anti-CA10/Carbonic anhydrase X, ALEXA Fluor 594 100 microliters 489 € Bioss Polyclonal Antibodies human
bs-11830R-A350 CA10/Carbonic anhydrase X Antibody, ALEXA FLUOR 350 100ul 332 € Bioss Primary Conjugated Antibodies. human
bs-11830R-A488 CA10/Carbonic anhydrase X Antibody, ALEXA FLUOR 488 100ul 332 € Bioss Primary Conjugated Antibodies. human
bs-11830R-A555 CA10/Carbonic anhydrase X Antibody, ALEXA FLUOR 555 100ul 332 € Bioss Primary Conjugated Antibodies. human
bs-11830R-A594 CA10/Carbonic anhydrase X Antibody, ALEXA FLUOR 594 100ul 332 € Bioss Primary Conjugated Antibodies. human
bs-11830R-A647 CA10/Carbonic anhydrase X Antibody, ALEXA FLUOR 647 100ul 332 € Bioss Primary Conjugated Antibodies. human
bs-11830R-Biotin CA10/Carbonic anhydrase X Antibody, Biotin Conjugated 0.1ml 333 € Bioss Primary Conjugated Antibodies human
bs-11830R CA10/Carbonic anhydrase X Antibody 0.1ml 263 € Bioss Primary Unconjugated Antibodies human
bs-11830R-Cy3 CA10/Carbonic anhydrase X Antibody, Cy3 Conjugated 0.1ml 350 € Bioss Primary Conjugated Antibodies human
bs-11830R-Cy5 CA10/Carbonic anhydrase X Antibody, Cy5 Conjugated 0.1ml 350 € Bioss Primary Conjugated Antibodies human
bs-11830R-Cy5.5 CA10/Carbonic anhydrase X Antibody, Cy5.5 Conjugated 0.1ml 350 € Bioss Primary Conjugated Antibodies human
bs-11830R-Cy7 CA10/Carbonic anhydrase X Antibody, Cy7 Conjugated 0.1ml 350 € Bioss Primary Conjugated Antibodies human
bs-11830R-FITC CA10/Carbonic anhydrase X Antibody, FITC Conjugated 0.1ml 333 € Bioss Primary Conjugated Antibodies human
bs-11830R-HRP CA10/Carbonic anhydrase X Antibody, HRP Conjugated 0.1ml 350 € Bioss Primary Conjugated Antibodies human
AE52805MO-48 ELISA test for Mouse Carbonic anhydrase-related protein 10 (CA10) 1x plate of 48 wells 373 € abebio mouse
AE52805MO-96 Mouse Carbonic anhydrase-related protein 10 (CA10) ELISA Kit 1x plate of 96 wells 612 € abebio mouse
C107 Recombinant Human Carbonic Anhydrase 1, CA1 (C-6His) 10 µg 110 € novo human
C108 Recombinant Human Carbonic Anhydrase 13, CA13 (C-6His) 1 mg 2283 € novo human
CG12 Recombinant Human Carbonic Anhydrase 14, CA14 (N-6His) 500 µg 1755 € novo human
CF26 Recombinant Human Carbonic Anhydrase 3, CA3 (C-6His) 50 µg 339 € novo human
C109 Recombinant Human Carbonic Anhydrase 4, CA4 (C-6His) 50 µg 496 € novo human
C110 Recombinant Human Carbonic Anhydrase 5B, CA5B (C-6His) 500 µg 1613 € novo human
C111 Recombinant Human Carbonic Anhydrase 7, CA7 (C-6His) 50 µg 232 € novo human
C112 Recombinant Human Carbonic Anhydrase 8, CA8 (C-6His) 10 µg 110 € novo human