Recombinant Human IGF2 mRNA-Binding Protein 2, IGF2BP2, IMP2 (C-6His, N-T7 tag)

Contact us
Catalog number: CE98
Price: 322 €
Supplier: ABM lentivectors
Product name: Recombinant Human IGF2 mRNA-Binding Protein 2, IGF2BP2, IMP2 (C-6His, N-T7 tag)
Quantity: 1.0 µg DNA
Other quantities: 1 mg 2486€ 50 µg 496€ 500 µg 1755€
Related search:

More details :

Reacts with: Human
Source: proteins, Recombinants or rec
Description: 6His tag at the C-terminus, Recombinant Human IGF2BP2 is produced by our E, coli expression system and the target gene encoding Met1-Thr220 is expressed with a T7 tag at the N-terminus
Molecular Weight: 2 kD, 27
UniProt number: Q9Y6M1
State of the product: Freeze-dried
Shipping conditions: Ambient temperature
Formulation: 150 mM sodium chloride, 2 um filtered solution of 20 mM PB, 4, Lyophilized from a 0, pH7
Storage recommendations: -20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at <
Reconstitution: Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml
Purity: and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid: MASMTGGQQMGRGSEFMMNKLYIGNLSPAVTADDLRQLFGDRKLPLAGQVLLKSGYAFVDYPDQNWAIRAIETLSGKVELHGKIMEVDYSVSKKLRSRKIQIRNIPPHLQWEVLDGLLAQYGTVENVEQVNTDTETAVVNVTYATREEAKIAMEKLSGHQFENYSFKISYIPDEEVSSPSPPQRAQRGDHSSREQGHAPGGTSQARQIDFPLRILVPTQFVGAIIGKEGLTIKNITLEHHHHHH
Levels of endotoxin: 11 IEU/ug, LAL test shows less than than 0
Properties: Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp
Group: recombinants
Gene target: IGF2BP2, IMP2 (C-6His, N-T7 tag), IGF2 mRNA-Binding Protein 2
Short name: IGF2BP2, IMP2 (C-6His, N-T7 tag), Recombinant IGF2 mRNA-Binding Protein 2
Technique: E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Label: tag
Species: Humans, Human
Alternative name: IMP2 (C-6His, N-T7 detection labelled), insulin-like growth factor 2 messenger RNA binding protein 2, sapiens insulin-like growth factor 2 (somatomedin A) messenger RNA-Binding Protein 2, recombinant H
Alternative technique: rec
Alternative to gene target: C11orf43 and IGF-II and PP9974, DNA-templated and biological process this GO :0007275 and multicellular organismal development and biological process this GO :0007565 and female pregnancy and biological process this GO :0007596 and blood coagulation and biological process this GO :0007613 and memory and biological process this GO :0008083 and growth factor activity and molecular function this GO :0008284 and positive regulation of cell proliferation and biological process this GO :0008286 and insulin receptor signaling pathway and biological process this GO :0009314 and response to radiation and biological process this GO :0009887 and organ morphogenesis and biological process this GO :0014070 and response to organic cyclic compound and biological process this GO :0030168 and platelet activation and biological process this GO :0030546 and receptor activator activity and molecular function this GO :0031017 and exocrine pancreas development and biological process this GO :0031093 and platelet alpha granule lumen and cellular component this GO :0031667 and response to nutrient levels and biological process this GO :0032355 and response to estradiol and biological process this GO :0035094 and response to nicotine and biological process this GO :0038028 and insulin receptor signaling pathway via phosphatidylinositol 3-kinase and biological process this GO :0042060 and wound healing and biological process this GO :0042104 and positive regulation of activated T cell proliferation and biological process this GO :0042493 and response to drug and biological process this GO :0043085 and positive regulation of catalytic activity and biological process this GO :0043410 and positive regulation of MAPK cascade and biological process this GO :0043539 and protein serine/threonine kinase activator activity and molecular function this GO :0044267 and cellular protein metabolic process and biological process this GO :0045471 and response to ethanol and biological process this GO :0045725 and positive regulation of glycogen biosynthetic process and biological process this GO :0045840 and positive regulation of mitosis and biological process this GO :0045944 and positive regulation of transcription from RNA polymerase II promoter and biological process this GO :0046628 and positive regulation of insulin receptor signaling pathway and biological process this GO :0050731 and positive regulation of peptidyl-tyrosine phosphorylation and biological process this GO :0051146 and striated muscle cell differentiation and biological process this GO :0051781 and positive regulation of cell division and biological process this GO :0051897 and positive regulation of protein kinase B signaling and biological process this GO :0070062 and extracellular vesicular exosome and cellular component this GO :0071260 and cellular response to mechanical stimulus and biological process this GO :0071902 and positive regulation of protein serine/threonine kinase activity and biological process this GO :0090031 and positive regulation of steroid hormone biosynthetic process and biological process this GO :2000273 and positive regulation of receptor activity and biological process this GO :2000467 and positive regulation of glycogen (starch) synthase activity and biological process, Extracellular, IGF2 and IDBG-20829 and ENSG00000167244 and 3481, IGF2 and IDBG-645244 and ENSBTAG00000013066 and 281240, IGF2BP2 and IDBG-634762 and ENSBTAG00000007666 and 519028, IGF2BP2 and IDBG-68594 and ENSG00000073792 and 10644, IMP-2 and IMP2 and VICKZ2, Igf2 and IDBG-212623 and ENSMUSG00000048583 and 16002, Igf2bp2 and IDBG-147890 and ENSMUSG00000033581 and 319765, insulin-like growth factor 2 mRNA binding protein 2, mRNA 5'-UTR binding, nuclei, protein serine/threonine kinase activator activity, this GO :0000166 and nucleotide binding and molecular function this GO :0003676 and nucleic acid binding and molecular function this GO :0003723 and RNA binding and molecular function this GO :0003729 and mRNA binding and molecular function this GO :0003730 and mRNA 3'-UTR binding and molecular function this GO :0005515 and protein binding and molecular function this GO :0005634 and nucleus and cellular component this GO :0005737 and cytoplasm and cellular component this GO :0005829 and cytosol and cellular component this GO :0005856 and cytoskeleton and cellular component this GO :0009653 and anatomical structure morphogenesis and biological process this GO :0010467 and gene expression and biological process this GO :0017148 and negative regulation of translation and biological process this GO :0042035 and regulation of cytokine biosynthetic process and biological process this GO :0044822 and poly(A) RNA binding and molecular function this GO :0045182 and translation regulator activity and molecular function this GO :0048027 and mRNA 5'-UTR binding and molecular function this GO :0051028 and mRNA transport and biological process, this GO :0000166 : nucleotide binding, this GO :0000166 : nucleotide binding and also this GO :0003676 : nucleic acid binding and also this GO :0003723 : RNA binding and also this GO :0003729 : mRNA binding and also this GO :0003730 : mRNA 3'-UTR binding and also this GO :0005515 : protein binding and also this GO :0044822 : poly(A) RNA binding and also this GO :0045182 : translation regulator activity and also this GO :0048027 : mRNA 5'-UTR binding, this GO :0001501 and skeletal system development and biological process this GO :0001649 and osteoblast differentiation and biological process this GO :0001934 and positive regulation of protein phosphorylation and biological process this GO :0002576 and platelet degranulation and biological process this GO :0005158 and insulin receptor binding and molecular function this GO :0005159 and insulin-like growth factor receptor binding and molecular function this GO :0005179 and hormone activity and molecular function this GO :0005515 and protein binding and molecular function this GO :0005576 and extracellular region and cellular component this GO :0005615 and extracellular space and cellular component this GO :0005886 and plasma membrane and cellular component this GO :0006006 and glucose metabolic process and biological process this GO :0006349 and regulation of gene expression by genetic imprinting and biological process this GO :0006355 and regulation of transcription, this GO :0003676 : nucleic acid binding, this GO :0003723 : RNA binding, this GO :0003729 : mRNA binding, this GO :0003730 : mRNA 3'-UTR binding, this GO :0005158 : insulin receptor binding, this GO :0005158 : insulin receptor binding and also this GO :0005159 : insulin-like growth factor receptor binding and also this GO :0005179 : hormone activity and also this GO :0005515 : protein binding and also this GO :0008083 : growth factor activity and also this GO :0030546 : receptor activator activity and also this GO :0043539 : protein serine/threonine kinase activator activity, this GO :0005159 : insulin-like growth factor receptor binding, this GO :0005179 : hormone activity, this GO :0005515 : protein binding, this GO :0005515 : protein binding, this GO :0008083 : growth factor activity, this GO :0030546 : receptor activator activity, this GO :0043539 : protein serine/threonine kinase activator activity, this GO :0044822 : poly(A) RNA binding, this GO :0045182 : translation regulator activity, this GO :0048027 : mRNA 5'-UTR binding, insulin-like growth factor 2 (somatomedin A)
Identity: 28867
Gene: IGF2BP2 | More about : IGF2BP2
Long gene name: insulin like growth factor 2 mRNA binding protein 2
Synonyms gene name: insulin-like growth factor 2 mRNA binding protein 2
Synonyms: IMP-2
Synonyms name: IGF II mRNA binding protein 2
Locus: 3q27, 2
Discovery year: 2006-02-09
GenBank acession: BC021290
Entrez gene record: 10644
Pubmed identfication: 10190901 9891060
RefSeq identity: NM_006548
Classification: RNA binding motif containing
Havana BLAST/BLAT: OTTHUMG00000074025

Related Products :

CE98 Recombinant Human IGF2 mRNA-Binding Protein 2, IGF2BP2, IMP2 (C-6His, N-T7 tag) 1 mg 2486 € novo human
MBS623041 IGF2BP2 (Insulin-like growth factor 2 mRNA binding protein 2, MP-2, IMP2, VICKZ2, p62, IGF II mRNA binding protein 2) Antibody 100ug 591 € MBS Polyclonals_1 human
GENTAUR-58bdcb0fde494 Anti- Insulin Like Growth Factor 2 mRNA Binding Protein 2 (IGF2BP2) Antibody 50ug 398 € MBS Polyclonals human
GENTAUR-58bdcb1057208 Anti- Insulin Like Growth Factor 2 mRNA Binding Protein 2 (IGF2BP2) Antibody 100ug 525 € MBS Polyclonals human
GENTAUR-58bdce10541bb Anti- Insulin Like Growth Factor 2 mRNA Binding Protein 2 (IGF2BP2) Antibody 50ug 404 € MBS Polyclonals human
GENTAUR-58bdce10c1b08 Anti- Insulin Like Growth Factor 2 mRNA Binding Protein 2 (IGF2BP2) Antibody 100ug 542 € MBS Polyclonals human
GENTAUR-58bdd2b55127f Anti- Insulin Like Growth Factor 2 mRNA Binding Protein 2 (IGF2BP2) Antibody 100ug 580 € MBS Polyclonals human
GENTAUR-58bdd314ae5cf Anti- Insulin Like Growth Factor 2 mRNA Binding Protein 2 (IGF2BP2) Antibody 100ug 569 € MBS Polyclonals human
GENTAUR-58bdd44ff0af0 Anti- Insulin Like Growth Factor 2 mRNA Binding Protein 2 (IGF2BP2) Antibody 100ug 608 € MBS Polyclonals human
GENTAUR-58bddbe585f53 Anti- Insulin Like Growth Factor 2 mRNA Binding Protein 2 (IGF2BP2) Antibody 100ug 625 € MBS Polyclonals human
MBS616311 PRP31 (Pre-mRNA Processing Factor 31, Pre-mRNA Processing Factor 31 Homolog (yeast), PRPF31, DKFZp566J153, hPrp31, NY-BR-99, Protein 61K, PRP31 Pre-mRNA Processing Factor 31 Homolog (yeast), RP11, Serologically Defined Breast Cancer Antigen NY-BR-99, U4/U 100ug 735 € MBS Polyclonals_1 human
GENTAUR-58bce2da79a70 Saccharomyces cerevisiae Mitochondrial inner membrane protease subunit 2 (IMP2) 1000ug 1509 € MBS Recombinant Proteins human
GENTAUR-58bce2dac78f5 Saccharomyces cerevisiae Mitochondrial inner membrane protease subunit 2 (IMP2) 1000ug 2017 € MBS Recombinant Proteins human
GENTAUR-58b8e5a09c099 Solanum lycopersicum Inositol monophosphatase 2 (IMP2) 100ug 1779 € MBS Recombinant Proteins human
GENTAUR-58b8e5a10790e Solanum lycopersicum Inositol monophosphatase 2 (IMP2) 1000ug 1779 € MBS Recombinant Proteins human
GENTAUR-58b8e5a15f5b7 Solanum lycopersicum Inositol monophosphatase 2 (IMP2) 100ug 2293 € MBS Recombinant Proteins human
GENTAUR-58b8e5a1a02e1 Solanum lycopersicum Inositol monophosphatase 2 (IMP2) 1000ug 2293 € MBS Recombinant Proteins human
GENTAUR-58b9e1c0a1724 Solanum lycopersicum Inositol monophosphatase 2 (IMP2) 100ug 1779 € MBS Recombinant Proteins human
GENTAUR-58b9e1c11a789 Solanum lycopersicum Inositol monophosphatase 2 (IMP2) 1000ug 1779 € MBS Recombinant Proteins human
GENTAUR-58b9e1c1682e4 Solanum lycopersicum Inositol monophosphatase 2 (IMP2) 100ug 2293 € MBS Recombinant Proteins human
GENTAUR-58b9e1c1c7acc Solanum lycopersicum Inositol monophosphatase 2 (IMP2) 1000ug 2293 € MBS Recombinant Proteins human
CF61 Recombinant Human Insulin-Like Growth Factor II, IGF2 50 µg 303 € novo human
MBS619150 Vesicular Stomatitis Virus Glycoprotein, Epitope Tag (Vesicular Stomatitis Virus Glycoprotein Tag, VSV Epitope Tag, VSV Tag, VSV-G Epitope Tag, VSV G, VSV-G) (FITC) Antibody 100ug 685 € MBS Polyclonals_1 virus
MBS623519 Apobec1, NT (Apolipoprotein B mRNA Editing Enzyme, Catalytic Polypeptide 1, ABEDP, CDAR1, HEPR, Apolipoprotein B mRNA Editing Enzyme) Antibody 200ul 603 € MBS Polyclonals_1 human
MBS620427 APOBEC2, aa12-26 (Apolipoprotein B mRNA editing enzyme, catalytic polypeptide-like 2, ARCD1, ARP1, OTTHUMP00000039773, apolipoprotein B mRNA editing enzyme, catalytic polypeptide 2) Antibody 100ug 591 € MBS Polyclonals_1 human
MBS622318 APOBEC2 (Apolipoprotein B mRNA Editing Enzyme Catalytic Polypeptide 2, Apolipoprotein B mRNA Editing Enzyme Catalytic Polypeptide-like 2, ARCD1, MGC128604) Antibody 100ug 735 € MBS Polyclonals_1 human
LV186969 IGF2BP2 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV) 1.0 µg DNA 322 € ABM lentivectors human
LV186970 IGF2BP2 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-C-term-HA) 1.0 µg DNA 322 € ABM lentivectors human
LV186971 IGF2BP2 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro) 1.0 µg DNA 322 € ABM lentivectors human
LV186972 IGF2BP2 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro) 1.0 µg DNA 322 € ABM lentivectors human