Recombinant Human DNA Fragmentation Factor Subunit α, DFFA, DFF45, ICAD (N-6His)

Contact us
Catalog number: CE91
Price: 500 €
Supplier: acr
Product name: Recombinant Human DNA Fragmentation Factor Subunit α, DFFA, DFF45, ICAD (N-6His)
Quantity: 0,1 mg
Other quantities: 1 mg 2283€ 10 µg 146€ 500 µg 1613€
Related search:

More details :

Reacts with: Human
Source: proteins, Recombinants or rec
Description: Recombinant Human DFF45 is produced by our E, coli expression system and the target gene encoding Met1-Thr331 is expressed with a 6His tag at the N-terminus
Molecular Weight: 38, 7 kD
UniProt number: O00273
State of the product: Liquid
Shipping conditions: Dry Ice/ice packs
Formulation: 150 mM sodium chloride, 2 um filtered solution of 20 mM PB, 4, Supplied as a 0, pH7
Storage recommendations: -20°, Please minimize freeze-thaw cycles, stable for 6 months after receipt, C, Store at <
Reconstitution: Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml
Purity: and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid: MGSSHHHHHHSSGLVPRGSHMEVTGDAGVPESGEIRTLKPCLLRRNYSREQHGVAASCLEDLRSKACDILAIDKSLTPVTLVLAEDGTIVDDDDYFLCLPSNTKFVALASNEKWAYNNSDGGTAWISQESFDVDETDSGAGLKWKNVARQLKEDLSSIILLSEEDLQMLVDAPCSDLAQELRQSCATVQRLQHTLQQVLDQREEVRQSKQLLQLYLQALEKEGSLLSKQEESKAAFGEEVDAVDTGISRETSSDVALASHILTALREKQAPELSLSSQDLELVTKEDPKALAVALNWDIKKTETVQEACEWELALRLQQTQSLHSLRSISASKASPPGDLQNPKRARQDPT
Levels of endotoxin: 11 IEU/ug, LAL test shows less than than 0
Properties: Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp
Group: recombinants
Gene target: DFF45, DFFA, ICAD (N-6His), DNA Fragmentation Factor Subunit &alpha
Short name: DFF45, DFFA, ICAD (N-6His), Recombinant DNA Fragmentation Factor Subunit &alpha
Technique: E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Species: Humans
Alternative name: 45kDa, DFF45, Desoxyribonucleic acid fragmentation factor, ICAD (N-6His), alpha polypeptide, sapiens Desoxyribonucleic acid Fragmentation Factor functionnal sequence &alpha, recombinant H
Alternative technique: rec
Alternative to gene target: 45kDa, DFF-45 and DFF1 and ICAD, DFFA and IDBG-89047 and ENSG00000160049 and 1676, Dffa and IDBG-204894 and ENSMUSG00000028974 and 13347, alpha polypeptide, nuclei, protein binding, this GO :0000790 and nuclear chromatin and cellular component this GO :0005515 and protein binding and molecular function this GO :0005622 and intracellular and cellular component this GO :0005634 and nucleus and cellular component this GO :0005654 and nucleoplasm and cellular component this GO :0005737 and cytoplasm and cellular component this GO :0005829 and cytosol and cellular component this GO :0006309 and apoptotic DNA fragmentation and biological process this GO :0006915 and apoptotic process and biological process this GO :0006921 and cellular component disassembly involved in execution phase of apoptosis and biological process this GO :0007165 and signal transduction and biological process this GO :0043065 and positive regulation of apoptotic process and biological process this GO :0070242 and thymocyte apoptotic process and biological process this GO :1900118 and negative regulation of execution phase of apoptosis and biological process this GO :1902511 and negative regulation of apoptotic DNA fragmentation and biological process, this GO :0005515 : protein binding, this GO :0005515 : protein binding, DNA fragmentation factor
Identity: 2772
Gene: DFFA | More about : DFFA
Long gene name: DNA fragmentation factor subunit alpha
Synonyms gene name: 45 kD, 45kDa, DNA fragmentation factor, alpha polypeptide , alpha polypeptide DNA fragmentation factor
Synonyms: DFF-45 DFF45 ICAD DFF1
Synonyms name: 45 kD, DNA fragmentation factor, alpha subunit
Locus: 1p36, 22
Discovery year: 1997-10-27
GenBank acession: AF087573
Entrez gene record: 1676
Pubmed identfication: 9605855 9108473
RefSeq identity: NM_004401
Havana BLAST/BLAT: OTTHUMG00000001909

Related Products :

CE91 Recombinant Human DNA Fragmentation Factor Subunit α, DFFA, DFF45, ICAD (N-6His) 500 µg 1613 € novo human
GWB-802B82 DNA Fragmentation Factor 45kDa Alpha Poly peptide sequence (DFF45/ICAD) (DFFA) Rabbit antibody to or anti-Human Polyclonal (aa313-331) antibody 1 volume 602 € genways human
MBS612126 DFF45, Cleavage Site (Asp224) (ICAD, DNA Fragmentation Factor, Inhibitor of Caspase Activated Deoxyribonuclease) Antibody 100ul 603 € MBS Polyclonals_1 human
MBS242955 Anti-Human DFFA / ICAD / DFF45 50ug 597 € MBS Polyclonals_1 human
MBS240364 Anti-Human DFFA / ICAD / DFF45 Antibody 50ug 597 € MBS Polyclonals_1 human
MBS280018 Anti-Human DNA Fragmentation Factor Subunit Alpha (DFFA) PAb 100ug 536 € MBS Polyclonals_1 human
GENTAUR-58bca7c91181f Human DNA fragmentation factor subunit alpha (DFFA) 100ug 1951 € MBS Recombinant Proteins human
GENTAUR-58bca7c95bc96 Human DNA fragmentation factor subunit alpha (DFFA) 1000ug 1951 € MBS Recombinant Proteins human
GENTAUR-58bca7c9a6d95 Human DNA fragmentation factor subunit alpha (DFFA) 100ug 2464 € MBS Recombinant Proteins human
GENTAUR-58bca7ca01f7a Human DNA fragmentation factor subunit alpha (DFFA) 1000ug 2464 € MBS Recombinant Proteins human
GENTAUR-58ba6650258ec Mouse DNA fragmentation factor subunit alpha (Dffa) 100ug 1951 € MBS Recombinant Proteins mouse
GENTAUR-58ba66508331d Mouse DNA fragmentation factor subunit alpha (Dffa) 1000ug 1951 € MBS Recombinant Proteins mouse
GENTAUR-58ba6650e5bce Mouse DNA fragmentation factor subunit alpha (Dffa) 100ug 2464 € MBS Recombinant Proteins mouse
GENTAUR-58ba6651db862 Mouse DNA fragmentation factor subunit alpha (Dffa) 1000ug 2464 € MBS Recombinant Proteins mouse
MBS617288 DFF35, 45 (ICAD, DNA Fragmentation Factor, Inhibitor of Caspase Activated Deoxyribonuclease) Antibody 100ul 564 € MBS Polyclonals_1 human
YSGAAM382E DFF45/ICAD, ~45 & ~40kD, Clone: 6B8, Mouse Monoclonal antibody-Human; WB 0.1mg 1394 € accurate-monoclonals human
bs-50464R ICAD (Inhibitor of CAD, DFF45) Antibody 0.1ml 354 € Bioss Primary Unconjugated Antibodies human
GENTAUR-58bcd9c5ba151 Poly-beta-1,6-N-acetyl-D-glucosamine synthesis protein IcaD (icaD) 1000ug 1321 € MBS Recombinant Proteins human
GENTAUR-58bcd9c614bfb Poly-beta-1,6-N-acetyl-D-glucosamine synthesis protein IcaD (icaD) 1000ug 1824 € MBS Recombinant Proteins human
AM26591AF-N anti-DFFA / ICAD (1-331) Antibody 0,1 mg 572 € acr human
AR09249PU-L anti-DFFA / ICAD (1-331, His-tag) Antibody 0,5 mg 1138 € acr human
AR09249PU-N anti-DFFA / ICAD (1-331, His-tag) Antibody 0,1 mg 485 € acr human
AP22848PU-N anti-DFFA / ICAD (2-21) Antibody 50 Вµg 732 € acr human
AP06798PU-N anti-DFFA / ICAD Antibody 0,1 mg 558 € acr human
AP07742PU-N anti-DFFA / ICAD Antibody 50 Вµg 732 € acr human
AP15521PU-M anti-DFFA / ICAD Antibody 0,5 ml 572 € acr human
AP15521PU-N anti-DFFA / ICAD Antibody 1 ml 688 € acr human
AP15521PU-S anti-DFFA / ICAD Antibody 0,1 ml 311 € acr human
C13041-1 anti-DFFA / ICAD Antibody 50 Вµg 347 € acr human
C13041-2 anti-DFFA / ICAD Antibody 0,1 mg 500 € acr human