Recombinant Human Testin, TES (C-6His)

Contact us
Catalog number: CE60
Price: 393 €
Supplier: MBS Polyclonals
Product name: Recombinant Human Testin, TES (C-6His)
Quantity: 100ug
Other quantities: 1 mg 2283€ 50 µg 369€ 500 µg 1613€
Related search:

More details :

Reacts with: Human
Source: proteins, Recombinants or rec
Description: Recombinant Human Testin is produced by our E, coli expression system and the target gene encoding Met1-Ser421 is expressed with a 6His tag at the C-terminus
Molecular Weight: 1 kD, 49
UniProt number: Q9UGI8
State of the product: Freeze-dried
Shipping conditions: Ambient temperature
Formulation: 1 mM DTT, 150 mM sodium chloride, pH 7, 2, 2 um filtered solution of 20 mM PB, Lyophilized from a 0
Storage recommendations: -20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at <
Reconstitution: Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml
Purity: and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid: MDLENKVKKMGLGHEQGFGAPCLKCKEKCEGFELHFWRKICRNCKCGQEEHDVLLSNEEDRKVGKLFEDTKYTTLIAKLKSDGIPMYKRNVMILTNPVAAKKNVSINTVTYEWAPPVQNQALARQYMQMLPKEKQPVAGSEGAQYRKKQLAKQLPAHDQDPSKCHELSPREVKEMEQFVKKYKSEALGVGDVKLPCEMDAQGPKQMNIPGGDRSTPAAVGAMEDKSAEHKRTQYSCYCCKLSMKEGDPAIYAERAGYDKLWHPACFVCSTCHELLVDMIYFWKNEKLYCGRHYCDSEKPRCAGCDELIFSNEYTQAENQNWHLKHFCCFDCDSILAGEIYVMVNDKPVCKPCYVKNHAVVCQGCHNAIDPEVQRVTYNNFSWHASTECFLCSCCSKCLIGQKFMPVEGMVFCSVECKKRMSLEHHHHHH
Levels of endotoxin: 11 IEU/ug, LAL test shows less than than 0
Properties: Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp
Group: recombinants
Gene target: TES (C-6His), Testin
Short name: TES (C-6His), Recombinant Testin
Technique: E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Species: Humans, Human
Alternative name: TES (C-6His), sapiens Testin, recombinant H
Alternative technique: rec
Identity: 14620
Gene: TES | More about : TES
Long gene name: testin LIM domain protein
Synonyms gene name: testis derived transcript (3 LIM domains)
Synonyms: DKFZP586B2022 TESS-2 TESTIN
Locus: 7q31, 2
Discovery year: 2001-06-29
GenBank acession: AJ250865
Entrez gene record: 26136
Pubmed identfication: 10950921
RefSeq identity: NM_015641
Classification: LIM domain containing
Havana BLAST/BLAT: OTTHUMG00000023092

Related Products :

CE60 Recombinant Human Testin, TES (C-6His) 1 mg 2283 € novo human
GENTAUR-58bb58b1d8302 Rat Testin-2 (Testin) 100ug 1912 € MBS Recombinant Proteins rat
GENTAUR-58bb58b2f0819 Rat Testin-2 (Testin) 1000ug 1912 € MBS Recombinant Proteins rat
GENTAUR-58bb58b331994 Rat Testin-2 (Testin) 100ug 2426 € MBS Recombinant Proteins rat
GENTAUR-58bb58b37a3b5 Rat Testin-2 (Testin) 1000ug 2426 € MBS Recombinant Proteins rat
AR09622PU-L anti-Testin / TES (1-421, His-tag) Antibody 0,25 mg 1500 € acr human
AR09622PU-N anti-Testin / TES (1-421, His-tag) Antibody 50 Вµg 587 € acr human
AE17013HO-48 ELISA test for Horse Testin (TES) 1x plate of 48 wells 402 € abebio horse
AE17019SH-48 ELISA test for Sheep Testin (TES) 1x plate of 48 wells 402 € abebio sheep
GENTAUR-58bd5e403e4af Horse Testin (TES) 100ug 2183 € MBS Recombinant Proteins horse
GENTAUR-58bd5e408ee8d Horse Testin (TES) 1000ug 2183 € MBS Recombinant Proteins horse
GENTAUR-58bd5e40d747b Horse Testin (TES) 100ug 2696 € MBS Recombinant Proteins horse
GENTAUR-58bd5e412c4e2 Horse Testin (TES) 1000ug 2696 € MBS Recombinant Proteins horse
AE17013HO-96 Horse Testin (TES) ELISA Kit 1x plate of 96 wells 671 € abebio horse
AE17019SH Sheep Testin (TES) ELISA Kit 96 wells plate 810 € ab-elisa elisas sheep
AE17019SH-96 Sheep Testin (TES) ELISA Kit 1x plate of 96 wells 671 € abebio sheep
GENTAUR-58bd8fd069a57 Xenopus laevis Testin (tes) 100ug 2183 € MBS Recombinant Proteins xenopus
GENTAUR-58bd8fd0c3acf Xenopus laevis Testin (tes) 1000ug 2183 € MBS Recombinant Proteins xenopus
GENTAUR-58bd8fd1245c1 Xenopus laevis Testin (tes) 100ug 2696 € MBS Recombinant Proteins xenopus
GENTAUR-58bd8fd16a40f Xenopus laevis Testin (tes) 1000ug 2696 € MBS Recombinant Proteins xenopus
GENTAUR-58bd617fe1f45 Xenopus tropicalis Testin (tes) 100ug 2183 € MBS Recombinant Proteins xenopus
GENTAUR-58bd6180351f3 Xenopus tropicalis Testin (tes) 1000ug 2183 € MBS Recombinant Proteins xenopus
GENTAUR-58bd61808443e Xenopus tropicalis Testin (tes) 100ug 2696 € MBS Recombinant Proteins xenopus
GENTAUR-58bd6180c8ace Xenopus tropicalis Testin (tes) 1000ug 2696 € MBS Recombinant Proteins xenopus
GWB-P1354B TES, 1-421aa, Recombinant Protein bulk Ask price € genways bulk human
abx251041 Anti-Human Testin ELISA Kit inquire 50 € abbex human
abx936503 Anti-TESTIN siRNA inquire 50 € abbex human
GWB-BSP689 TES Human Protein bulk Ask price € genways bulk human
LV332802 TES Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV) 1.0 µg DNA 322 € ABM lentivectors human
GENTAUR-58be44b31f1cc Anti- TES Antibody 100ug 393 € MBS Polyclonals human