Recombinant Human Calcineurin Subunit B1, CNB1 (N-6His)

Contact us
Catalog number: CE42
Price: 597 €
Supplier: MBS Polyclonals_1
Product name: Recombinant Human Calcineurin Subunit B1, CNB1 (N-6His)
Quantity: 200ul
Other quantities: 1 mg 2283€ 10 µg 202€ 50 µg 496€
Related search:

More details :

Reacts with: Human
Source: proteins, Recombinants or rec
Description: Recombinant Human Calcineurin Subunit B1 is produced by our E, coli expression system and the target gene encoding Met1-Val170 is expressed with a 6His tag at the N-terminus
Molecular Weight: 21, 46 kD
UniProt number: P63098
State of the product: Freeze-dried
Shipping conditions: Ambient temperature
Formulation: 100 mM sodium chloride, 2 mM DTT, pH 8, 0 , 2 um filtered solution of 20 mM TrisHCl, Lyophilized from a 0
Storage recommendations: -20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at <
Reconstitution: Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml
Purity: and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid: MGSSHHHHHHSSGLVPRGSHMGNEASYPLEMCSHFDADEIKRLGKRFKKLDLDNSGSLSVEEFMSLPELQQNPLVQRVIDIFDTDGNGEVDFKEFIEGVSQFSVKGDKEQKLRFAFRIYDMDKDGYISNGELFQVLKMMVGNNLKDTQLQQIVDKTIINADKDGDGRISFEEFCAVVGGLDIHKKMVVDV
Levels of endotoxin: 11 IEU/ug, LAL test shows less than than 0
Properties: Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp
Group: recombinants
Gene target: CNB1 (N-6His), Calcineurin Subunit B1
Short name: CNB1 (N-6His), Recombinant Calcineurin Subunit B1
Technique: E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Species: Humans, Human
Alternative name: CNB1 (N-6His), sapiens Calcineurin functionnal sequence B1, recombinant H
Alternative technique: rec
Identity: 9317
Gene: PPP3R1 | More about : PPP3R1
Long gene name: alpha , protein phosphatase 3 regulatory subunit B
Synonyms gene name: 19kDa, alpha , alpha isoform (calcineurin B, alpha isoform (calcineurin B, alpha isoform protein phosphatase 3, protein phosphatase 3 (formerly 2B), regulatory subunit B, regulatory subunit B, regulatory subunit B, regulatory subunit B (19kD), type I) protein phosphatase 3 (formerly 2B), type I) protein phosphatase 3 (formerly 2B)
Synonyms: CALNB1 CNB CNB1
Synonyms name: calcineurin B, type I (19kDa) protein phosphatase 2B regulatory subunit B alpha
Locus: 2p14
Discovery year: 1993-01-25
GenBank acession: M30773
Entrez gene record: 5534
Pubmed identfication: 8978785 2558868
RefSeq identity: NM_000945
Classification: Protein phosphatase 3 regulatory subunits EF-hand domain containing
Havana BLAST/BLAT: OTTHUMG00000129561

Related Products :

CE42 Recombinant Human Calcineurin Subunit B1, CNB1 (N-6His) 1 mg 2283 € novo human
GENTAUR-58bda9c7db3fd Yarrowia lipolytica Calcineurin subunit B (CNB1) 100ug 1553 € MBS Recombinant Proteins human
GENTAUR-58bda9c84474c Yarrowia lipolytica Calcineurin subunit B (CNB1) 1000ug 1553 € MBS Recombinant Proteins human
GENTAUR-58bda9c89799f Yarrowia lipolytica Calcineurin subunit B (CNB1) 100ug 2056 € MBS Recombinant Proteins human
GENTAUR-58bda9c912925 Yarrowia lipolytica Calcineurin subunit B (CNB1) 1000ug 2056 € MBS Recombinant Proteins human
MBS624149 Calcipressin 3, CT (Regulator of Calcineurin 3, Down Syndrome Candidate Region 1-like Protein 2, Myocyte-enriched Calcineurin Interacting Protein 3, MCIP3, DSCR1L2, RCAN3) Antibody 200ul 597 € MBS Polyclonals_1 human
abx261088 Anti-Calcineurin-Like Phosphoesterase Domain Containing 1 Protein (Recombinant) 1 mg 3559 € abbex human
abx261975 Anti-Regulator of Calcineurin 1 Protein (Recombinant) 1 mg 4675 € abbex human
abx261526 Anti-Regulator of Calcineurin 2 Protein (Recombinant) 1 mg 3559 € abbex human
abx262561 Anti-Regulator of Calcineurin 3 Protein (Recombinant) 1 mg 6662 € abbex human
abx250774 Anti-Human Calcineurin subunit B type 1 ELISA Kit 96 tests 659 € abbex human
BYA9048-1 Calcineurin, alpha subunit, Clone: CN-A1, Mouse Monoclonal antibody-Rat, Bovine, Human; paraffin 0.2 ml 569 € accurate-monoclonals human
GWB-5D9683 Calcineurin B Subunit Isoform 1 (PPP3R1) Rabbit antibody to or anti-Human Polyclonal antibody 1 tube 648 € genways human
BYA9036-1 Calcineurin, ß subunit, 18kD, Clone: CN-B1, Mouse Monoclonal antibody-Rat, Bovine, Human; paraffin 0.2 ml 569 € accurate-monoclonals human
CALNA12-P Human Calcineurin A-subunit Control/blocking peptide 100 μg 188 € adi human
CALNA15-R Human Calcineurin A-subunit protein biologically active 1000 U 405 € adi human
CALNA12-C Human Calcineurin A-subunit protein WB +Ve control 100 μL 333 € adi human
CALNB21-C Human Calcineurin B -subunit protein WB +Ve control 100 μL 333 € adi human
CALNA13-M Monoclonal Anti-Human Calcineurin A-subunit ascites 100 μL 565 € adi human
CALNA12-A Rabbit Anti-Human Calcineurin A-subunit IgG aff pure 100 μg 565 € adi human
abx256480 Anti-Rat Calcineurin subunit B type 1 ELISA Kit inquire 50 € abbex rat
GENTAUR-58bcbc1a390af Drosophila melanogaster Calcineurin subunit B type 1 (CanB) 100ug 1547 € MBS Recombinant Proteins drosophila
GENTAUR-58bcbc1a6be3c Drosophila melanogaster Calcineurin subunit B type 1 (CanB) 1000ug 1547 € MBS Recombinant Proteins drosophila
GENTAUR-58bcbc1ab0ecd Drosophila melanogaster Calcineurin subunit B type 1 (CanB) 100ug 2050 € MBS Recombinant Proteins drosophila
GENTAUR-58bcbc1b0197f Drosophila melanogaster Calcineurin subunit B type 1 (CanB) 1000ug 2050 € MBS Recombinant Proteins drosophila
CALNB21-S Rabbit Anti-Mouse Calcineurin B subunit antiserum 100 μL 536 € adi mouse
abx570171 Anti-Human Calcineurin (CaN) ELISA Kit inquire 50 € abbex human
abx150899 Anti-Human Calcineurin ELISA Kit inquire 50 € abbex human
abx252135 Anti-Human Calcineurin ELISA Kit inquire 50 € abbex human
MBS247724 Anti-Human PPP3CA / CCN1 / Calcineurin A Antibody 200ul 597 € MBS Polyclonals_1 human