Recombinant Human Growth Factor Receptor-Bound Protein 2, GRB2, ASH (C-6His)

Contact us
Catalog number: CE35
Price: 564 €
Supplier: MBS Polyclonals
Product name: Recombinant Human Growth Factor Receptor-Bound Protein 2, GRB2, ASH (C-6His)
Quantity: 100ug
Other quantities: 1 mg 2283€ 50 µg 496€ 500 µg 1613€
Related search:

More details :

Reacts with: Human
Source: proteins, Recombinants or rec
Description: Recombinant Human GRB2 is produced by our E, coli expression system and the target gene encoding Met1-Val217 is expressed with a 6His tag at the C-terminus
Molecular Weight: 26, 3 kD
UniProt number: P62993
State of the product: Freeze-dried
Shipping conditions: Ambient temperature
Formulation: 150 mM sodium chloride, pH 8, 2 um filtered solution of 20 mM TrisHCl, Lyophilized from a 0
Storage recommendations: -20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at <
Reconstitution: Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml
Purity: and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid: MEAIAKYDFKATADDELSFKRGDILKVLNEECDQNWYKAELNGKDGFIPKNYIEMKPHPWFFGKIPRAKAEEMLSKQRHDGAFLIRESESAPGDFSLSVKFGNDVQHFKVLRDGAGKYFLWVVKFNSLNELVDYHRSTSVSRNQQIFLRDIEQVPQQPTYVQALFDFDPQEDGELGFRRGDFIHVMDNSDPNWWKGACHGQTGMFPRNYVTPVNRNVLEHHHHHH
Levels of endotoxin: 11 IEU/ug, LAL test shows less than than 0
Properties: Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp
Group: recombinants
Gene target: ASH (C-6His), GRB2, Growth Factor Receptor-Bound Protein 2
Short name: ASH (C-6His), GRB2, Recombinant Growth Factor Receptor-Bound Protein 2
Technique: E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Species: Humans, Human
Alternative name: ASH (C-6His), GRB2, sapiens Growth Factor Receptor-Bound Protein 2, recombinant H
Alternative technique: rec
Identity: 4566
Gene: GRB2 | More about : GRB2
Long gene name: growth factor receptor bound protein 2
Synonyms gene name: growth factor receptor-bound protein 2
Synonyms: NCKAP2
Locus: 17q25, 1
Discovery year: 1994-03-04
Entrez gene record: 2885
Pubmed identfication: 10051406
RefSeq identity: NM_002086
Classification: SH2 domain containing
Havana BLAST/BLAT: OTTHUMG00000134332

Related Products :

CE35 Recombinant Human Growth Factor Receptor-Bound Protein 2, GRB2, ASH (C-6His) 500 µg 1613 € novo human
BMDV10244 GRB2 (Growth Factor Receptor-Bound Protein 2), sem5, ASH Signalling Protein, 24-25kD, Clone: 2GB02, Mouse Monoclonal antibody-Human; WB 500ul 808 € accurate-monoclonals human
MBS616558 GRAP2 (GRB2 Related Adaptor Protein 2, GRB2 Like Protein, GADS, GRB2 Related Protein With Insert Domain, GRB2L, GRBLG, GrbX, Grf40, GRID, Growth Factor Receptor Binding Protein, GRPL, SH3-SH2-SH3 Adaptor Molecule) Antibody 200ug 580 € MBS Polyclonals_1 human
MBS611950 Nerve Growth Factor, beta (NGF, Beta Nerve Growth Factor, Beta Nerve Growth Factor Precursor, Beta NGF, HSAN5, Nerve Growth Factor beta, Nerve Growth Factor beta Polypeptide, Nerve Growth Factor beta Subunit, NGFB) 500ug 652 € MBS Polyclonals_1 human
DL-Grb2-Hu Human Growth Factor Receptor Bound Protein 2 Grb2 ELISA Kit 96T 846 € DL elisas human
PRO-50037-0020 anti-GRB2 / ASH (1-217) Antibody 20 Вµg 268 € acr human
PRO-50037-0050 anti-GRB2 / ASH (1-217) Antibody 50 Вµg 355 € acr human
PRO-50037-0100 anti-GRB2 / ASH (1-217) Antibody 0,1 mg 514 € acr human
PRO-50038-0020 anti-GRB2 / ASH (1-217) Antibody 20 Вµg 268 € acr human
PRO-50038-0050 anti-GRB2 / ASH (1-217) Antibody 50 Вµg 355 € acr human
PRO-50038-0100 anti-GRB2 / ASH (1-217) Antibody 0,1 mg 514 € acr human
AR09166PU-L anti-GRB2 / ASH (1-217, His-tag) Antibody 0,5 mg 1138 € acr human
AR09166PU-N anti-GRB2 / ASH (1-217, His-tag) Antibody 0,1 mg 485 € acr human
AP03043PU-N anti-GRB2 / ASH (198-217) Antibody 0,1 mg 427 € acr human
AP13279PU-N anti-GRB2 / ASH Antibody 0,4 ml 587 € acr human
AP21184PU-N anti-GRB2 / ASH Antibody 0,1 mg 558 € acr human
AP23089PU-N anti-GRB2 / ASH Antibody 50 Вµl 732 € acr human
BB-PA1579 anti-GRB2 / ASH Antibody 0,1 mg 471 € acr human
C15972-1 anti-GRB2 / ASH Antibody 50 Вµg 347 € acr human
C15972-2 anti-GRB2 / ASH Antibody 0,1 mg 500 € acr human
CPA4422-100ul anti-GRB2 / ASH Antibody 0,1 ml 442 € acr human
CPA4422-200ul anti-GRB2 / ASH Antibody 0,2 ml 688 € acr human
CPA4422-30ul anti-GRB2 / ASH Antibody 30 Вµl 326 € acr human
AP23021PU-N anti-GRB2 / ASH (C-term) Antibody 50 Вµg 732 € acr human
AP23211PU-N anti-GRB2 / ASH (C-term) Antibody 50 Вµg 732 € acr human
AM26660PU-N anti-GRB2 / ASH (N-term) Antibody 0,1 ml 572 € acr human
GENTAUR-58bdc8d80ff93 Anti- Growth Factor Receptor Bound Protein 2 (Grb2) Antibody 100ug 492 € MBS Polyclonals human
GENTAUR-58bdc8d86f127 Anti- Growth Factor Receptor Bound Protein 2 (Grb2) Antibody 50ug 376 € MBS Polyclonals human
GENTAUR-58bdd3a2c724e Anti- Growth Factor Receptor Bound Protein 2 (Grb2) Antibody 100ug 525 € MBS Polyclonals human
GENTAUR-58bdd501c065a Anti- Growth Factor Receptor Bound Protein 2 (Grb2) Antibody 100ug 564 € MBS Polyclonals human